Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant rat Interleukin-18 protein

Product Specifications

CAS Number

9000-83-3

Gene Name

Interleukin 18

Gene Aliases

IFN-gamma-inducing factor; IL-1 gamma; IL-18; interferon gamma-inducing factor; interleukin-1 gamma; interleukin-18.

Gene ID

29197

Reactivity

Rat|Rattus norvegicus

Target

A proinflammatory cytokine primarily involved in polarized T-helper 1 (Th1) cell and natural killer (NK) cell immune responses. Upon binding to IL18R1 and IL18RAP, forms a signaling ternary complex which activates NF-kappa-B, triggering synthesis of inflammatory mediators. Synergizes with IL12/interleukin-12 to induce IFNG synthesis from T-helper 1 (Th1) cells and natural killer (NK) cells.

Type

Protein

Source

E.coli

Sequence

HFGRLHCTTAVIRSINDQVLFVDKRNPPVFEDMPDIDRTANESQTRLIIYMYKDSEVRGLAVTLSVKDGRMSTLSCKNKIISFEEMNPPENIDDIKSDLIFFQKRVPGHNKMEFESSLYEGHFLACQKEDDAFKLVLKRKDENGDKSVMFTLTNLHQS

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

22.3 kDa

Protein Length

Recombinant

NCBI Gene Symbol

Il18

Protein Name

Interleukin-18

Gene Name URL

Il18

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Oct-3/4 shRNA (h) Lentiviral Particles
sc-36123-V 200 µL

Oct-3/4 shRNA (h) Lentiviral Particles

Sign In for Pricing
View Details
Kcnk3 ORF Vector (Mouse) (pORF)
25400014 1.0 µg DNA

Kcnk3 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
SAAP Fraction 3
MBS5822040 Inquire

SAAP Fraction 3

Sign In for Pricing
View Details
Mouse Tinag qPCR Primer Pair
QM24902S 200 Tests

Mouse Tinag qPCR Primer Pair

Sign In for Pricing
View Details
Thiambutene hydrochloride
290103-01 25 mg

Thiambutene hydrochloride

Sign In for Pricing
View Details
Thiambutene hydrochloride
290103-02 50 mg

Thiambutene hydrochloride

Sign In for Pricing
View Details