Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MT2A Recombinant Protein (Human)

Product Specifications

CAS Number

9000-83-3

Gene Name

Metallothionein 2A

Gene Aliases

Metallothionein-2; Metallothionein-2A; metallothionein-II; MT2; MT-2; MT-II.

Gene ID

4502

Reactivity

Homo sapiens|Human

Target

Metallothioneins have a high content of cysteine residues that bind various heavy metals; these proteins are transcriptionally regulated by both heavy metals and glucocorticoids.

Type

Protein

Source

E.coli

Sequence

MDPNCSCAAGDSCTCAGSCKCKECKCTSCKKSCCSCCPVGCAKCAQGCICKGASDKCSC

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

32.9 kDa

Protein Length

Recombinant

NCBI Gene Symbol

MT2A

Protein Name

Metallothionein-2

Gene Name URL

MT2A

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal mtRNA polymerase Antibody [mFluor Violet 450 SE]
NBP3-18334MFV450 0.1 mL

Rabbit Polyclonal mtRNA polymerase Antibody [mFluor Violet 450 SE]

Sign In for Pricing
View Details
TFAP2B (Transcription Factor AP-2 beta (Activating Enhancer Binding Protein 2 beta), AP-2B, AP2-B, MGC21381) (PE)
252556-PE 100 µL

TFAP2B (Transcription Factor AP-2 beta (Activating Enhancer Binding Protein 2 beta), AP-2B, AP2-B, MGC21381) (PE)

Sign In for Pricing
View Details
ATF3 Rabbit pAb
E45R24402N-50 50 µL

ATF3 Rabbit pAb

Sign In for Pricing
View Details
HBEGF Antibody / DT-R
RQ7309 100 µg

HBEGF Antibody / DT-R

Sign In for Pricing
View Details
Sec24c (NM_172596) Mouse Recombinant Protein
TP511625 20 µg

Sec24c (NM_172596) Mouse Recombinant Protein

Sign In for Pricing
View Details
Purified Mouse Anti-species independent N-sulfated heparan sulfate Antibody *HepSS-1, monoclonal*
V1031880-AAT 0.1 mg

Purified Mouse Anti-species independent N-sulfated heparan sulfate Antibody *HepSS-1, monoclonal*

Sign In for Pricing
View Details