Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Angiopoietin-2

Product Specifications

CAS Number

9000-83-3

Gene Name

Angiopoietin 2

Gene Aliases

Agpt2; An; Ang; Ang2; Ang-2; angiopoietin-2.

Gene ID

11601

Reactivity

Mouse|Mus musculus

Target

Binds to TEK/TIE2, competing for the ANGPT1 binding site, and modulating ANGPT1 signaling. Can induce tyrosine phosphorylation of TEK/TIE2 in the absence of ANGPT1. In the absence of angiogenic inducers, such as VEGF, ANGPT2-mediated loosening of cell-matrix contacts may induce endothelial cell apoptosis with consequent vascular regression. In concert with VEGF, it may facilitate endothelial cell migration and proliferation, thus serving as a permissive angiogenic signal (By similarity) .

Type

Protein

Source

E.coli

Sequence

YSNFRKSVDSTGRRQYQVQNGPCSYTFLLPETDSCRSSSSPYMSNAVQRDAPLDYDDSVQRLQVLENILENNTQWLMKLENYIQDNMKKEMVEIQQNVVQNQTAVMIEIGTSLLNQTAAQTRKLTDVEAQVLNQTTRLELQLLQHSISTNKLEKQILDQTSEINKLQNKNSFLEQKVLDMEGKHSEQLQSMKEQKDELQVLVSKQSSVIDELEKKLVTATVNNSLLQKQQHDLMETVNSLLTMMSSPNSKSSVAIRKEEQTTFRDCAEIFKSGLTTSGIYTLTFPNSTEEIKAYCDMDVGGGGWTVIQHREDGSVDFQRTWKEYKEGFGSPLGEYWLGNEFVSQLTGQHRYVLKIQLKDWEGNEAHSLYDHFYLAGEESNYRIHLTGLTGTAGKISSISQPGSDFSTKDSDNDKCICKCSQMLSGGWWFDACGPSNLNGQYYPQKQNTNKFNGIKWYYWKGSGYS

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

57 kDa

Protein Length

Recombinant

NCBI Gene Symbol

Angpt2

Protein Name

Angiopoietin-2

Gene Name URL

Angpt2

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human FAM21C shRNA Plasmid
abx966650-01 150 µg

Human FAM21C shRNA Plasmid

Sign In for Pricing
View Details
Human FAM21C shRNA Plasmid
abx966650-02 300 µg

Human FAM21C shRNA Plasmid

Sign In for Pricing
View Details
Caspase-4 Rabbit Monoclonal Antibody
AMRe87504-01 1 Each

Caspase-4 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Caspase-4 Rabbit Monoclonal Antibody
AMRe87504-02 50 µL

Caspase-4 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Caspase-4 Rabbit Monoclonal Antibody
AMRe87504-03 100 µL

Caspase-4 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Slc7a3 antibody
70R-8576 100 µL

Slc7a3 antibody

Sign In for Pricing
View Details