Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Interleukin-18-binding protein

Product Specifications

CAS Number

9000-83-3

Gene Name

Interleukin 18 binding protein

Gene Aliases

Igi; Igifbp; IL-1; IL-18BP; interferon gamma-inducing factor-binding protein; interleukin-18-binding protein; MC54; MC54L.

Gene ID

16068

Reactivity

Mouse|Mus musculus

Target

Binds to IL-18 and inhibits its activity. Functions as an inhibitor of the early TH1 cytokine response (By similarity) .

Type

Protein

Source

E.coli

Sequence

TSAPQTTATVLTGSSKDPCSSWSPAVPTKQYPALDVIWPEKEVPLNGTLTLSCTACSRFPYFSILYWLGNGSFIEHLPGRLKEGHTSREHRNTSTWLHRALVLEELSPTLRSTNFSCLFVDPGQVAQYHIILAQLWDGLKTAPSPSQETLSSHSPVSRSAGPGVA

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

22 kda

Protein Length

Recombinant

NCBI Gene Symbol

Il18bp

Protein Name

Interleukin-18-binding protein

Gene Name URL

Il18bp

More Discoveries

Explore Other Products

Browse additional items from our catalog

GSTA4 siRNA (Rat)
MBS8215116-01 15 nmol

GSTA4 siRNA (Rat)

Sign In for Pricing
View Details
GSTA4 siRNA (Rat)
MBS8215116-02 30 nmol

GSTA4 siRNA (Rat)

Sign In for Pricing
View Details
GSTA4 siRNA (Rat)
MBS8215116-03 5x 30 nmol

GSTA4 siRNA (Rat)

Sign In for Pricing
View Details
Chromogranin A / CHGA (Neuroendocrine Marker) Antibody - With BSA and Azide
orb1462689-01 20 µg

Chromogranin A / CHGA (Neuroendocrine Marker) Antibody - With BSA and Azide

Sign In for Pricing
View Details
Chromogranin A / CHGA (Neuroendocrine Marker) Antibody - With BSA and Azide
orb1462689-02 100 µg

Chromogranin A / CHGA (Neuroendocrine Marker) Antibody - With BSA and Azide

Sign In for Pricing
View Details
AADACL3 (Arylacetamide Deacetylase-like 3)
474418 100 µL

AADACL3 (Arylacetamide Deacetylase-like 3)

Sign In for Pricing
View Details