Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant rat Metallo proteinase inhibitor 1

Product Specifications

CAS Number

9000-83-3

Gene Name

TIMP metallopeptidase inhibitor 1

Gene Aliases

Metalloproteinase inhibitor 1; Timp; TIMP-1; tissue inhibitor of metallopeptidase 1; tissue inhibitor of metalloproteinase 1; tissue inhibitor of metalloproteinases 1.

Gene ID

116510

Reactivity

Rat|Rattus norvegicus

Target

Metalloproteinase inhibitor that functions by forming one to one complexes with target metalloproteinases, such as collagenases, and irreversibly inactivates them by binding to their catalytic zinc cofactor. Acts on MMP1, MMP2, MMP3, MMP7, MMP8, MMP9, MMP10, MMP11, MMP12, MMP13 and MMP16. Does not act on MMP14. Also functions as a growth factor that regulates cell differentiation, migration and cell death and activates cellular signaling cascades via CD63 and ITGB1. Plays a role in integrin signaling. Also stimulates steroidogenesis by Leydig and ovarian granuloma cells; procathepsin L is required for maximal activity.

Type

Protein

Source

E.coli

Sequence

CSCAPTHPQTAFCNSDLVIRAKFMGSPEIIETTLYQRYEIKMTKMLKGFDAVGNATGFRFAYTPAMESLCGYVHKSQNRSEEFLIAGRLRNGNLHITACSFLVPWHNLSPAQQKAFVKTYSAGCGVCTVFPCSAIPCKLESDSHCLWTDQILMGSEKGYQSDHFACLPRNPDLCTWQYLGVSMTRSLPLAKAEA

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

25.5 kDa

Protein Length

Recombinant

NCBI Gene Symbol

Timp1

Protein Name

Metalloproteinase inhibitor 1

Gene Name URL

Timp1

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ACTH (Adrenocorticotrophic Hormone) (AH26), CF640R conjugate, 0.1mg/mL
BNC400026-500 1x 500 µL

ACTH (Adrenocorticotrophic Hormone) (AH26), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD10 (CB-CALLA), CF555 conjugate, 0.1mg/mL
BNC550146-500 1x 500 µL

CD10 (CB-CALLA), CF555 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Complement C4d (C4D204), CF488A conjugate, 0.1mg/mL
BNC880204-100 1x 100 µL

Complement C4d (C4D204), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human IgG Immunoglobulin (IG266), CF568 conjugate, 0.1mg/mL
BNC680266-500 1x 500 µL

Human IgG Immunoglobulin (IG266), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P21 / WAF1 (WA-1), CF647 conjugate, 0.1mg/mL
BNC470043-100 1x 100 µL

P21 / WAF1 (WA-1), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Fibronectin (TV-1), CF740 conjugate, 0.1mg/mL
BNC740029-500 1x 500 µL

Fibronectin (TV-1), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details