Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant rat Brain-derived neurotrophic factor

Product Specifications

CAS Number

9000-83-3

Gene Name

Brain-derived neurotrophic factor

Gene Aliases

Brain derived neurothrophic factor; brain-derived neurotrophic factor.

Gene ID

24225

Reactivity

Rat|Rattus norvegicus

Target

During development, promotes the survival and differentiation of selected neuronal populations of the peripheral and central nervous systems. Participates in axonal growth, pathfinding and in the modulation of dendritic growth and morphology. Major regulator of synaptic transmission and plasticity at adult synapses in many regions of the CNS (By similarity) .

Type

Protein

Source

E.coli

Sequence

RRGELSVCDSISEWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEGCRGIDKRHWNSQCRTTQSYVRALTMDSKKRIGWRFIRIDTSCVCTL

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

16.3 kDa

Protein Length

Recombinant

NCBI Gene Symbol

Bdnf

Protein Name

Brain-derived neurotrophic factor

Gene Name URL

Bdnf

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Histone H1 (AE-4), CF405S conjugate, 0.1mg/mL
BNC040096-500 1x 500 µL

Histone H1 (AE-4), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD86 (BU63), CF640R conjugate, 0.1mg/mL
BNC400193-500 1x 500 µL

CD86 (BU63), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD35 / CR1 (E11), CF647 conjugate, 0.1mg/mL
BNC470040-100 1x 100 µL

CD35 / CR1 (E11), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD28 (204.12), CF568 conjugate, 0.1mg/mL
BNC680164-100 1x 100 µL

CD28 (204.12), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details