Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant E.coli Adenylate kinase protein

Product Specifications

CAS Number

9000-83-3

Gene Name

Adenylate kinase

Gene Aliases

Adenylate kinase; Adenylate monophosphate kinase; ATP:AMP phosphotransferase; ATP-AMP transphosphorylase; b0474; dnaW; ECK0468; plsA.

Gene ID

945097

Reactivity

Escherichia coli

Target

Catalyzes the reversible transfer of the terminal phosphate group between ATP and AMP. Plays an important role in cellular energy homeostasis and in adenine nucleotide metabolism.

Type

Protein

Source

E.coli

Sequence

MRIILLGAPGAGKGTQAQFIMEKYGIPQISTGDMLRAAVKSGSELGKQAKDIMDAGKLVTDELVIALVKERIAQEDCRNGFLLDGFPRTIPQADAMKEAGINVDYVLEFDVPDELIVDRIVGRRVHAPSGRVYHVKFNPPKVEGKDDVTGEELTTRKDDQEETVRKRLVEYHQMTAPLIGYYSKEAEAGNTKYAKVDGTKPVAEVRADLEKILG

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

27.6 kDa

Protein Length

Recombinant

NCBI Gene Symbol

Adk

Protein Name

Adenylate kinase

Gene Name URL

Adk

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FITC-Linked Polyclonal Antibody to Glycoprotein 39, Cartilage (GP39)
MBS2055445-01 0.1 mL

FITC-Linked Polyclonal Antibody to Glycoprotein 39, Cartilage (GP39)

Sign In for Pricing
View Details
FITC-Linked Polyclonal Antibody to Glycoprotein 39, Cartilage (GP39)
MBS2055445-02 0.2 mL

FITC-Linked Polyclonal Antibody to Glycoprotein 39, Cartilage (GP39)

Sign In for Pricing
View Details
FITC-Linked Polyclonal Antibody to Glycoprotein 39, Cartilage (GP39)
MBS2055445-03 0.5 mL

FITC-Linked Polyclonal Antibody to Glycoprotein 39, Cartilage (GP39)

Sign In for Pricing
View Details
FITC-Linked Polyclonal Antibody to Glycoprotein 39, Cartilage (GP39)
MBS2055445-04 1 mL

FITC-Linked Polyclonal Antibody to Glycoprotein 39, Cartilage (GP39)

Sign In for Pricing
View Details
FITC-Linked Polyclonal Antibody to Glycoprotein 39, Cartilage (GP39)
MBS2055445-05 5 mL

FITC-Linked Polyclonal Antibody to Glycoprotein 39, Cartilage (GP39)

Sign In for Pricing
View Details
FITC-Linked Polyclonal Antibody to Glycoprotein 39, Cartilage (GP39)
MBS2055445-06 5x 5 mL

FITC-Linked Polyclonal Antibody to Glycoprotein 39, Cartilage (GP39)

Sign In for Pricing
View Details