Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RPA3 Recombinant Protein (Human)

Product Specifications

CAS Number

9000-83-3

Gene Name

Replication protein A3

Gene Aliases

REPA3; replication factor A protein 3; replication protein A 14 kDa subunit; replication protein A3, 14kDa; RF-A protein 3; RP-A p14.

Gene ID

6119

Reactivity

Homo sapiens|Human

Target

As part of the heterotrimeric replication protein A complex (RPA/RP-A), binds and stabilizes single-stranded DNA intermediates that form during DNA replication or upon DNA stress. It prevents their reannealing and in parallel, recruits and activates different proteins and complexes involved in DNA metabolism. Thereby, it plays an essential role both in DNA replication and the cellular response to DNA damage (PubMed:9430682) . In the cellular response to DNA damage, the RPA complex controls DNA repair and DNA damage checkpoint activation. Through recruitment of ATRIP activates the ATR kinase a master regulator of the DNA damage response (PubMed:24332808) . It is required for the recruitment of the DNA double-strand break repair factors RAD51 and RAD52 to chromatin, in response to DNA damage. Also recruits to sites of DNA damage proteins like XPA and XPG that are involved in nucleotide excision repair and is required for this mechanism of DNA repair (PubMed:7697716) . Plays also a role in base excision repair (BER), probably through interaction with UNG (PubMed:9765279) . Also recruits SMARCAL1/HARP, which is involved in replication fork restart, to sites of DNA damage. May also play a role in telomere maintenance. RPA3 has its own single-stranded DNA-binding activity and may be responsible for polarity of the binding of the complex to DNA (PubMed:19010961) . As part of the alternative replication protein A complex, aRPA, binds single-stranded DNA and probably plays a role in DNA repair. Compared to the RPA2-containing, canonical RPA complex, may not support chromosomal DNA replication and cell cycle progression through S-phase. The aRPA may not promote efficient priming by DNA polymerase alpha but could support DNA synthesis by polymerase delta in presence of PCNA and replication factor C (RFC), the dual incision/excision reaction of nucleotide excision repair and RAD51-dependent strand exchange (PubMed:19996105) .

Type

Protein

Source

E.coli

Sequence

MVDMMDLPRSRINAGMLAQFIDKPVCFVGRLEKIHPTGKMFILSDGEGKNGTIELMEPLDEEISGIVEVVGRVTAKATILCTSYVQFKEDSHPFDLGLYNEAVKIIHDFPQFYPLGIVQ

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

40.3 kDa

Protein Length

Recombinant

NCBI Gene Symbol

RPA3

Protein Name

Replication protein A 14 kDa subunit

Gene Name URL

RPA3

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GLUR2 Polyclonal Antibody, PE-Cy5.5 Conjugated
bs-1798R-PE-Cy5.5 100 µL

GLUR2 Polyclonal Antibody, PE-Cy5.5 Conjugated

Sign In for Pricing
View Details
Hsa-miR-500b-5p antagomir
HY-RI01505A-01 5 nmol

Hsa-miR-500b-5p antagomir

Sign In for Pricing
View Details
Hsa-miR-500b-5p antagomir
HY-RI01505A-02 20 nmol

Hsa-miR-500b-5p antagomir

Sign In for Pricing
View Details
Human RPS3 protein
orb754327-01 50 µg

Human RPS3 protein

Sign In for Pricing
View Details
Human RPS3 protein
orb754327-02 100 µg

Human RPS3 protein

Sign In for Pricing
View Details
Human RPS3 protein
orb754327-03 200 µg

Human RPS3 protein

Sign In for Pricing
View Details