Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HPRT1 Recombinant Protein (Human)

Product Specifications

CAS Number

9000-83-3

Gene Name

Hypoxanthine phosphoribosyltransferase 1

Gene Aliases

HGPRT; HGPRTase; HPRT; hypoxanthine-guanine phosphoribosyltransferase; hypoxanthine-guanine phosphoribosyltransferase 1; testicular tissue protein Li 89.

Gene ID

3251

Reactivity

Homo sapiens|Human

Target

Converts guanine to guanosine monophosphate, and hypoxanthine to inosine monophosphate. Transfers the 5-phosphoribosyl group from 5-phosphoribosylpyrophosphate onto the purine. Plays a central role in the generation of purine nucleotides through the purine salvage pathway.

Type

Protein

Source

E.coli

Sequence

ATRSPGVVISDDEPGYDLDLFCIPNHYAEDLERVFIPHGLIMDRTERLARDVMKEMGGHHIVALCVLKGGYKFFADLLDYIKALNRNSDRSIPMTVDFIRLKSYCNDQSTGDIKVIGGDDLSTLTGKNVLIVEDIIDTGKTMQTLLSLVRQYNPKMVKVASLLVKRTPRSVGYKPDFVGFEIPDKFVVGYALDYNEYFRDLNHVCVISETGKAKYKA

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

28.4 kDa

Protein Length

Recombinant

NCBI Gene Symbol

HPRT1

Protein Name

Hypoxanthine-guanine phosphoribosyltransferase

Gene Name URL

HPRT1

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PCDH7 Rabbit pAb, BF700 conjugated
orb2838541 100 µL

PCDH7 Rabbit pAb, BF700 conjugated

Sign In for Pricing
View Details
Recombinant Shigella flexneri serotype 5b Uncharacterized Nudix hydrolase NudL (nudL)
MBS1442880-01 0.02 mg (E-Coli)

Recombinant Shigella flexneri serotype 5b Uncharacterized Nudix hydrolase NudL (nudL)

Sign In for Pricing
View Details
Recombinant Shigella flexneri serotype 5b Uncharacterized Nudix hydrolase NudL (nudL)
MBS1442880-02 0.1 mg (E-Coli)

Recombinant Shigella flexneri serotype 5b Uncharacterized Nudix hydrolase NudL (nudL)

Sign In for Pricing
View Details
Recombinant Shigella flexneri serotype 5b Uncharacterized Nudix hydrolase NudL (nudL)
MBS1442880-03 0.02 mg (Yeast)

Recombinant Shigella flexneri serotype 5b Uncharacterized Nudix hydrolase NudL (nudL)

Sign In for Pricing
View Details
Recombinant Shigella flexneri serotype 5b Uncharacterized Nudix hydrolase NudL (nudL)
MBS1442880-04 0.1 mg (Yeast)

Recombinant Shigella flexneri serotype 5b Uncharacterized Nudix hydrolase NudL (nudL)

Sign In for Pricing
View Details
Recombinant Shigella flexneri serotype 5b Uncharacterized Nudix hydrolase NudL (nudL)
MBS1442880-05 0.02 mg (Baculovirus)

Recombinant Shigella flexneri serotype 5b Uncharacterized Nudix hydrolase NudL (nudL)

Sign In for Pricing
View Details