Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Ba (Mycobacterium tuberculosis) Phosphate-binding protein PstS 1

Product Specifications

CAS Number

9000-83-3

Gene Aliases

Antigen Ag78; Protein antigen B.

Reactivity

Mycobacterium tuberculosis

Target

Part of the ABC transporter complex PstSACB involved in phosphate import.

Type

Protein

Source

E.coli

Sequence

CGSKPPSGSPETGAGAGTVATTPASSPVTLAETGSTLLYPLFNLWGPAFHERYPNVTITAQGTGSGAGIAQAAAGTVNIGASDAYLSEGDMAAHKGLMNIALAISAQQVNYNLPGVSEHLKLNGKVLAAMYQGTIKTWDDPQIAALNPGVNLPGTAVVPLHRSDGSGDTFLFTQYLSKQDPEGWGKSPGFGTTVDFPAVPGALGENGNGGMVTGCAETPGCVAYIGISFLDQASQRGLGEAQLGNSSGNFLLPDAQSIQAAAAGFASKTPANQAISMIDGPAPDGYPIINYEYAIVNNRQKDAATAQTLQAFLHWAITDGNKASFLDQVHFQPLPPAVVKLSDALIATIS

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

39.8 kDa

Protein Length

Recombinant

NCBI Gene Symbol

PSTS1

Protein Name

Phosphate-binding protein PstS 1

Gene Name URL

PSTS1

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CTRL CRISPRa sgRNA lentivector (set of three targets)(Rat)
17087126 3x 1.0µg DNA

CTRL CRISPRa sgRNA lentivector (set of three targets)(Rat)

Sign In for Pricing
View Details
Tubulysin M-d3
TRC-T897133-25MG 25 mg

Tubulysin M-d3

Sign In for Pricing
View Details
GPN2 AAV siRNA Pooled Vector
22477161 1.0 µg

GPN2 AAV siRNA Pooled Vector

Sign In for Pricing
View Details
YEATS2 Rabbit pAb
orb2711858-01 50 µL

YEATS2 Rabbit pAb

Sign In for Pricing
View Details
YEATS2 Rabbit pAb
orb2711858-02 100 µL

YEATS2 Rabbit pAb

Sign In for Pricing
View Details
Recombinant Schizosaccharomyces pombe Uncharacterized RING finger protein C57A7.09 (SPAC57A7.09)
MBS7040290-01 0.02 mg

Recombinant Schizosaccharomyces pombe Uncharacterized RING finger protein C57A7.09 (SPAC57A7.09)

Sign In for Pricing
View Details