Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Egl nine homolog 3 protein

Product Specifications

CAS Number

9000-83-3

Gene Name

Egl-9 family hypoxia-inducible factor 3

Gene Aliases

2610021G09Rik; AI505553; AI648162; Hif-p4h; Hif-p4h-3; HIF-PH3; HIF-prolyl hydroxylase 3; HPH-3; hypoxia-inducible factor prolyl hydroxylase 3; Phd; Phd3; prolyl hydroxylase domain-containing protein 3; prolyl hydroxylase EGLN3; SM-2; SM-20.

Gene ID

112407

Reactivity

Mouse|Mus musculus

Target

Plays a crucial role in DNA damage response (DDR) by hydroxylating TELO2, promoting its interaction with ATR which is required for activation of the ATR/CHK1/p53 pathway (By similarity) . Cellular oxygen sensor that catalyzes, under normoxic conditions, the post-translational formation of 4-hydroxyproline in hypoxia-inducible factor (HIF) alpha proteins. Hydroxylates a specific proline found in each of the oxygen-dependent degradation (ODD) domains (N-terminal, NODD, and C-terminal, CODD) of HIF1A. Also hydroxylates HIF2A. Has a preference for the CODD site for both HIF1A and HIF2A. Hydroxylation on the NODD site by EGLN3 appears to require prior hydroxylation on the CODD site. Hydroxylated HIFs are then targeted for proteasomal degradation via the von Hippel-Lindau ubiquitination complex. Under hypoxic conditions, the hydroxylation reaction is attenuated allowing HIFs to escape degradation resulting in their translocation to the nucleus, heterodimerization with HIF1B, and increased expression of hypoxy-inducible genes. ELGN3 is the most important isozyme in limiting physiological activation of HIFs (particularly HIF2A) in hypoxia. Also hydroxylates PKM in hypoxia, limiting glycolysis. Under normoxia, hydroxylates and regulates the stability of ADRB2. Regulator of cardiomyocyte and neuronal apoptosis. In cardiomyocytes, inhibits the anti-apoptotic effect of BCL2 by disrupting the BAX-BCL2 complex. In neurons, has a NGF-induced proapoptotic effect, probably through regulating CASP3 activity. Also essential for hypoxic regulation of neutrophilic inflammation. Target proteins are preferentially recognized via a LXXLAP motif.

Type

Protein

Source

E.coli

Sequence

PLGHIMRLDLEKIALEYIVPCLHEVGFCYLDNFLGEVVGDCVLERVKQLHYNGALRDGQLAGPRAGVSKRHLRGDQITWIGGNEEGCEAINFLLSLIDRLVLYCGSRLGKYYVKERSKAMVACYPGNGTGYVRHVDNPNGDGRCITCIYYLNKNWDAKLHGGVLRIFPEGKSFVADVEPIFDRLLFFWSDRRNPHEVQPSYATRYAMTVWYFDAEERAEAKKKFRNLTRKTESALAKD

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

31.2 kDa

Protein Length

Recombinant

NCBI Gene Symbol

Egln3

Protein Name

Egl nine homolog 3

Gene Name URL

Egln3

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Prochlorococcus marinus Putative pterin-4-alpha-carbinolamine dehydratase (P9301_05181)
MBS1174133-01 0.02 mg (E-Coli)

Recombinant Prochlorococcus marinus Putative pterin-4-alpha-carbinolamine dehydratase (P9301_05181)

Sign In for Pricing
View Details
Recombinant Prochlorococcus marinus Putative pterin-4-alpha-carbinolamine dehydratase (P9301_05181)
MBS1174133-02 0.1 mg (E-Coli)

Recombinant Prochlorococcus marinus Putative pterin-4-alpha-carbinolamine dehydratase (P9301_05181)

Sign In for Pricing
View Details
Recombinant Prochlorococcus marinus Putative pterin-4-alpha-carbinolamine dehydratase (P9301_05181)
MBS1174133-03 0.02 mg (Yeast)

Recombinant Prochlorococcus marinus Putative pterin-4-alpha-carbinolamine dehydratase (P9301_05181)

Sign In for Pricing
View Details
Recombinant Prochlorococcus marinus Putative pterin-4-alpha-carbinolamine dehydratase (P9301_05181)
MBS1174133-04 0.1 mg (Yeast)

Recombinant Prochlorococcus marinus Putative pterin-4-alpha-carbinolamine dehydratase (P9301_05181)

Sign In for Pricing
View Details
Recombinant Prochlorococcus marinus Putative pterin-4-alpha-carbinolamine dehydratase (P9301_05181)
MBS1174133-05 0.02 mg (Baculovirus)

Recombinant Prochlorococcus marinus Putative pterin-4-alpha-carbinolamine dehydratase (P9301_05181)

Sign In for Pricing
View Details
Recombinant Prochlorococcus marinus Putative pterin-4-alpha-carbinolamine dehydratase (P9301_05181)
MBS1174133-06 1 mg (E-Coli)

Recombinant Prochlorococcus marinus Putative pterin-4-alpha-carbinolamine dehydratase (P9301_05181)

Sign In for Pricing
View Details