Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant human Glutamyl aminopeptidase

Product Specifications

CAS Number

9000-83-3

Gene Name

Glutamyl aminopeptidase

Gene Aliases

Aminopeptidase A; APA; AP-A; CD249; differentiation antigen gp160; EAP; glutamyl aminopeptidase; gp160.

Gene ID

2028

Reactivity

Homo sapiens|Human

Target

Regulates central hypertension through its calcium-modulated preference to cleave N-terminal acidic residues from peptides such as angiotensin II.

Type

Protein

Source

E.coli

Sequence

YFQGQVKPIADSLGWNDAGDHVTKLLRSSVLGFACKMGDREALNNASSLFEQWLNGTVSLPVNLRLLVYRYGMQNSGNEISWNYTLEQYQKTSLAQEKEKLLYGLASVKNVTLLSRYLDLLKDTNLIKTQDVFTVIRYISYNSYGKNMAWNWIQLNWDYLVNRYTLNNRNLGRIVTIAEPFNTELQLWQMESFFAKYPQAGAGEKPREQVLETVKNNIEWLKQHRNTIREW

Purification

Affinity purified using IMAC

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Concentration

Varies by lot. See vial for exact concentration.

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

31 kDa

Protein Length

Recombinant

NCBI Gene Symbol

ENPEP

Protein Name

Glutamyl aminopeptidase

Gene Name URL

ENPEP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

6430537H07Rik (BC023285) Mouse Tagged ORF Clone
MR205208 10 µg

6430537H07Rik (BC023285) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
ARN2966 10mg
A21016-10 10 mg

ARN2966 10mg

Sign In for Pricing
View Details
Tcl1 (TCL1A) Human Over-expression Lysate
orb1350403 100 µg

Tcl1 (TCL1A) Human Over-expression Lysate

Sign In for Pricing
View Details
Mouse Thrombin activatable fibrinolysis inhibitor, TAFI ELISA Kit
MBS164167-01 48 Well

Mouse Thrombin activatable fibrinolysis inhibitor, TAFI ELISA Kit

Sign In for Pricing
View Details
Mouse Thrombin activatable fibrinolysis inhibitor, TAFI ELISA Kit
MBS164167-02 96 Well

Mouse Thrombin activatable fibrinolysis inhibitor, TAFI ELISA Kit

Sign In for Pricing
View Details
Mouse Thrombin activatable fibrinolysis inhibitor, TAFI ELISA Kit
MBS164167-03 5x 96 Well

Mouse Thrombin activatable fibrinolysis inhibitor, TAFI ELISA Kit

Sign In for Pricing
View Details