Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant human Glutamyl aminopeptidase

Product Specifications

CAS Number

9000-83-3

Gene Name

Glutamyl aminopeptidase

Gene Aliases

Aminopeptidase A; APA; AP-A; CD249; differentiation antigen gp160; EAP; glutamyl aminopeptidase; gp160.

Gene ID

2028

Reactivity

Homo sapiens|Human

Target

Regulates central hypertension through its calcium-modulated preference to cleave N-terminal acidic residues from peptides such as angiotensin II.

Type

Protein

Source

E.coli

Sequence

YFQGQVKPIADSLGWNDAGDHVTKLLRSSVLGFACKMGDREALNNASSLFEQWLNGTVSLPVNLRLLVYRYGMQNSGNEISWNYTLEQYQKTSLAQEKEKLLYGLASVKNVTLLSRYLDLLKDTNLIKTQDVFTVIRYISYNSYGKNMAWNWIQLNWDYLVNRYTLNNRNLGRIVTIAEPFNTELQLWQMESFFAKYPQAGAGEKPREQVLETVKNNIEWLKQHRNTIREW

Purification

Affinity purified using IMAC

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Concentration

Varies by lot. See vial for exact concentration.

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

31 kDa

Protein Length

Recombinant

NCBI Gene Symbol

ENPEP

Protein Name

Glutamyl aminopeptidase

Gene Name URL

ENPEP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TMEM146 CRISPR All-in-one AAV vector set (with saCas9)(Human)
46903151 3x 1.0 µg DNA

TMEM146 CRISPR All-in-one AAV vector set (with saCas9)(Human)

Sign In for Pricing
View Details
KSR2 (Kinase Suppressor of Ras 2, Kinase Suppressor of Ras-2, FLJ25965) (MaxLight 490)
207754-ML490 100 µL

KSR2 (Kinase Suppressor of Ras 2, Kinase Suppressor of Ras-2, FLJ25965) (MaxLight 490)

Sign In for Pricing
View Details
PerM Antibody
orb818303 2 mg

PerM Antibody

Sign In for Pricing
View Details
Porcine Olfactory receptor 6C65 (OR6C65) ELISA Kit
MBS7247026-01 48 Well

Porcine Olfactory receptor 6C65 (OR6C65) ELISA Kit

Sign In for Pricing
View Details
Porcine Olfactory receptor 6C65 (OR6C65) ELISA Kit
MBS7247026-02 96 Well

Porcine Olfactory receptor 6C65 (OR6C65) ELISA Kit

Sign In for Pricing
View Details
Porcine Olfactory receptor 6C65 (OR6C65) ELISA Kit
MBS7247026-03 5x 96 Well

Porcine Olfactory receptor 6C65 (OR6C65) ELISA Kit

Sign In for Pricing
View Details