Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Influenza A virus Matrix protein 2 (M2), partial

Product Specifications

Abbreviation

Recombinant Influenza A virus Matrix protein 2, partial

Gene Name

M2

UniProt

A0A088G224

Expression Region

1-22aa&44-97aa

Organism

Influenza A virus (A/New York/WC-LVD-14-006/2014 (H1N1) )

Target Sequence

MSLLTEVETPTRSEWECRCSGSGGGGSGGGGSDRLFFKCIYRRFKYGLKRGPSTEGVPESMREEYQQEQQSAVDVDDGHFVNIELE

Tag

C-terminal 10xHis-tagged

Type

In Stock Protein

Source

Mammalian cell

Field of Research

Others

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

10.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HDHD2 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
LV710811 1.0 µg DNA

HDHD2 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
DOCK4 (Dedicator of Cytokinesis Protein 4, FLJ34238, KIAA0716, MGC134911, MGC134912) (HRP)
MBS6152200-01 0.1 mL

DOCK4 (Dedicator of Cytokinesis Protein 4, FLJ34238, KIAA0716, MGC134911, MGC134912) (HRP)

Sign In for Pricing
View Details
DOCK4 (Dedicator of Cytokinesis Protein 4, FLJ34238, KIAA0716, MGC134911, MGC134912) (HRP)
MBS6152200-02 5x 0.1 mL

DOCK4 (Dedicator of Cytokinesis Protein 4, FLJ34238, KIAA0716, MGC134911, MGC134912) (HRP)

Sign In for Pricing
View Details
2-Phenyl-2- (piperidin-1-yl) acetonitrile
OR300829 1 g

2-Phenyl-2- (piperidin-1-yl) acetonitrile

Sign In for Pricing
View Details
CCDC71L Human shRNA Lentiviral Particle (Locus ID 168455)
TL307779V 500 µL Each

CCDC71L Human shRNA Lentiviral Particle (Locus ID 168455)

Sign In for Pricing
View Details
ELISA Kit For Ectonucleoside triphosphate diphosphohydrolase 1
E9075m 96 Tests

ELISA Kit For Ectonucleoside triphosphate diphosphohydrolase 1

Sign In for Pricing
View Details