Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Influenza A virus Matrix protein 2 (M2), partial

Product Specifications

Abbreviation

Recombinant Influenza A virus Matrix protein 2, partial

Gene Name

M2

UniProt

A0A088G224

Expression Region

1-22aa&44-97aa

Organism

Influenza A virus (A/New York/WC-LVD-14-006/2014 (H1N1) )

Target Sequence

MSLLTEVETPTRSEWECRCSGSGGGGSGGGGSDRLFFKCIYRRFKYGLKRGPSTEGVPESMREEYQQEQQSAVDVDDGHFVNIELE

Tag

C-terminal 10xHis-tagged

Type

In Stock Protein

Source

Mammalian cell

Field of Research

Others

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

10.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DZIP1 (C-7) Alexa Fluor® 790
sc-515454 AF790 200 µg/mL

DZIP1 (C-7) Alexa Fluor® 790

Sign In for Pricing
View Details
SULT1C4 Rabbit Polyclonal Antibody (HRP)
orb2114057 100 µL

SULT1C4 Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details
Recombinant Hum j 6
A10V07 1 Each

Recombinant Hum j 6

Sign In for Pricing
View Details
ANXA11, Control Peptide (Annexin A11, Annexin-11, Annexin XI, Calcyclin-associated Annexin 50, CAP-50, 56kD Autoantigen, ANX11)
147414 100 µg

ANXA11, Control Peptide (Annexin A11, Annexin-11, Annexin XI, Calcyclin-associated Annexin 50, CAP-50, 56kD Autoantigen, ANX11)

Sign In for Pricing
View Details
Beta Defensin 1 Rabbit mAb
E2R382398 100 µL

Beta Defensin 1 Rabbit mAb

Sign In for Pricing
View Details
MEK3/MAP2K3 Rabbit Polyclonal Antibody (Cy3)
orb2579196 100 µg

MEK3/MAP2K3 Rabbit Polyclonal Antibody (Cy3)

Sign In for Pricing
View Details