Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ABP1 Recombinant Protein (Maize)

Product Specifications

CAS Number

9000-83-3

Gene Aliases

ERABP1.

Reactivity

Zea mays

Target

Receptor for the plant hormone auxin.

Type

Protein

Source

E.coli

Sequence

SCVRDNSLVRDISQMPQSSYGIEGLSHITVAGALNHGMKEVEVWLQTISPGQRTPIHRHSCEEVFTVLKGKGTLLMGSSSLKYPGQPQEIPFFQNTTFSIPVNDPHQVWNSDEHEDLQVLVIISRPPAKIFLYDDWSMPHTAAVLKFPFVWDEDCFEAAKDEL

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

22.4 kDa

Protein Length

Recombinant

NCBI Gene Symbol

ABP1

Protein Name

Auxin-binding protein 1

Gene Name URL

ABP1

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ORAI1, CT (Transmembrane Protein 142A, TMEM142A, Calcium Release-Activated Calcium Channel Protein 1) (MaxLight 550)
O7044-03-ML550 100 µL

ORAI1, CT (Transmembrane Protein 142A, TMEM142A, Calcium Release-Activated Calcium Channel Protein 1) (MaxLight 550)

Sign In for Pricing
View Details
Olr1520 (NM_001000714) Rat Tagged ORF Clone Lentiviral Particle
RR207200L3V 200 µL

Olr1520 (NM_001000714) Rat Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
MPZ, Recombinant, Human, aa30-156, His-Tag (Myelin Protein P0)
374258-01 20 µg

MPZ, Recombinant, Human, aa30-156, His-Tag (Myelin Protein P0)

Sign In for Pricing
View Details
MPZ, Recombinant, Human, aa30-156, His-Tag (Myelin Protein P0)
374258-02 100 µg

MPZ, Recombinant, Human, aa30-156, His-Tag (Myelin Protein P0)

Sign In for Pricing
View Details
Scissors, Dissecting, Blunt Ends
4011150/1A 1 Each

Scissors, Dissecting, Blunt Ends

Sign In for Pricing
View Details
(11Z,14Z) -Ethyl icosa-11,14-dienoate
HY-W750583-01 25 mg

(11Z,14Z) -Ethyl icosa-11,14-dienoate

Sign In for Pricing
View Details