Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GRIN2A Recombinant Protein (Human)

Product Specifications

CAS Number

9000-83-3

Gene Name

Glutamate ionotropic receptor NMDA type subunit 2A

Gene Aliases

EPND; FESD; GluN2A; Glutamate [NMDA] receptor subunit epsilon-1; glutamate ionotropic receptor NMDA 2A; glutamate receptor ionotropic, NMDA 2A; glutamate receptor, ionotropic, N-methyl D-aspartate 2A; LKS; NMDAR2A; N-methyl D-aspartate receptor subtype 2A; N-methyl-D-aspartate receptor channel, subunit epsilon-1; N-methyl-D-aspartate receptor subunit 2A; NR2A.

Gene ID

2903

Reactivity

Homo sapiens|Human

Target

Component of NMDA receptor complexes that function as heterotetrameric, ligand-gated ion channels with high calcium permeability and voltage-dependent sensitivity to magnesium. Channel activation requires binding of the neurotransmitter glutamate to the epsilon subunit, glycine binding to the zeta subunit, plus membrane depolarization to eliminate channel inhibition by Mg (2+) (PubMed:8768735, PubMed:26919761, PubMed:26875626, PubMed:28105280) . Sensitivity to glutamate and channel kinetics depend on the subunit composition; channels containing GRIN1 and GRIN2A have higher sensitivity to glutamate and faster kinetics than channels formed by GRIN1 and GRIN2B (PubMed:26919761, PubMed:26875626) . Contributes to the slow phase of excitatory postsynaptic current, long-term synaptic potentiation, and learning (By similarity) .

Type

Protein

Source

E.coli

Sequence

VYQRAVMAVGSLTINEERSEVVDFSVPFVETGISVMVSRSNGTVSPSAFLIGKAIWLLWGLVFNNSVPVQNPKGTTSKIMMHQYMTKFNQKGVEDALVSLKTGKLDAFIYDAAVLNYKAGRDEGCKLVTI

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

18.2 kDa

Protein Length

Recombinant

NCBI Gene Symbol

GRIN2A

Protein Name

Glutamate receptor ionotropic, NMDA 2A

Gene Name URL

GRIN2A

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD73 (NT5E) Human Over-expression Lysate
orb1365389 20 µg

CD73 (NT5E) Human Over-expression Lysate

Sign In for Pricing
View Details
CYP7B1 (3U10) Mouse Monoclonal antibody
E28PE2378 100 µL

CYP7B1 (3U10) Mouse Monoclonal antibody

Sign In for Pricing
View Details
γ-Oxo-4-pyridinebutyric Acid
TRC-O859190-500MG 500 mg

γ-Oxo-4-pyridinebutyric Acid

Sign In for Pricing
View Details
Casr-set siRNA/shRNA/RNAi Lentivector (Mouse)
15082094 4x 500 ng

Casr-set siRNA/shRNA/RNAi Lentivector (Mouse)

Sign In for Pricing
View Details
DARS Antibody
KC-2771-01 50 μL

DARS Antibody

Sign In for Pricing
View Details
DARS Antibody
KC-2771-02 100 µL

DARS Antibody

Sign In for Pricing
View Details