Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BTUF Recombinant Protein (Escherichia coli)

Product Specifications

CAS Number

9000-83-3

Gene Name

Vitamin B12 ABC transporter periplasmic binding protein

Gene Aliases

B0158; ECK0157; vitamin B12 ABC transporter periplasmic binding protein; yadT.

Gene ID

947574

Reactivity

Escherichia coli

Target

Part of the ABC transporter complex BtuCDF involved in vitamin B12 import. Binds vitamin B12 and delivers it to the periplasmic surface of BtuC.

Type

Protein

Source

E.coli

Sequence

PRVITLSPANTELAFAAGITPVGVSSYSDYPPQAQKIEQVSTWQGMNLERIVALKPDLVIAWRGGNAERQVDQLASLGIKVMWVDATSIEQIANALRQLAPWSPQPDKAEQAAQSLLDQYAQLKAQYADKPKKRVFLQFGINPPFTSGKESIQNQVLEVCGGENIFKDSRVPWPQVSREQVLARSPQAIVITGGPDQIPKIKQYWGEQLKIPVIPLTSDWFERASPRIILAAQQLCNALSQVD

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

30.9 kDa

Protein Length

Recombinant

NCBI Gene Symbol

BtuF

Protein Name

Vitamin B12-binding protein

Gene Name URL

BtuF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Glod5 ORF Vector (Rat) (pORF)
21613016 1.0 µg DNA

Glod5 ORF Vector (Rat) (pORF)

Sign In for Pricing
View Details
GOT2P5 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
LV726911 1.0 µg DNA

GOT2P5 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
FITC anti-human CD303 (BDCA-2)
GT09414 100 Tests

FITC anti-human CD303 (BDCA-2)

Sign In for Pricing
View Details
BRP44 (Brain Protein 44, DKFZp564B167, MGC125752, MGC125753) (MaxLight 550)
243889-ML550 100 µL

BRP44 (Brain Protein 44, DKFZp564B167, MGC125752, MGC125753) (MaxLight 550)

Sign In for Pricing
View Details
SEN15 shRNA Plasmid (m)
sc-153335-SH 20 µg

SEN15 shRNA Plasmid (m)

Sign In for Pricing
View Details
Gemin 4 Polyclonal Antibody, PerCP Conjugated
bs-13328R-PerCP 100 µL

Gemin 4 Polyclonal Antibody, PerCP Conjugated

Sign In for Pricing
View Details