Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BTUF Recombinant Protein (Escherichia coli)

Product Specifications

CAS Number

9000-83-3

Gene Name

Vitamin B12 ABC transporter periplasmic binding protein

Gene Aliases

B0158; ECK0157; vitamin B12 ABC transporter periplasmic binding protein; yadT.

Gene ID

947574

Reactivity

Escherichia coli

Target

Part of the ABC transporter complex BtuCDF involved in vitamin B12 import. Binds vitamin B12 and delivers it to the periplasmic surface of BtuC.

Type

Protein

Source

E.coli

Sequence

PRVITLSPANTELAFAAGITPVGVSSYSDYPPQAQKIEQVSTWQGMNLERIVALKPDLVIAWRGGNAERQVDQLASLGIKVMWVDATSIEQIANALRQLAPWSPQPDKAEQAAQSLLDQYAQLKAQYADKPKKRVFLQFGINPPFTSGKESIQNQVLEVCGGENIFKDSRVPWPQVSREQVLARSPQAIVITGGPDQIPKIKQYWGEQLKIPVIPLTSDWFERASPRIILAAQQLCNALSQVD

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

53.9 kDa

Protein Length

Recombinant

NCBI Gene Symbol

BtuF

Protein Name

Vitamin B12-binding protein

Gene Name URL

BtuF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Goat anti-histidine decarboxylase (aa449-462) Antibody
dAP-3279 50 µg

Goat anti-histidine decarboxylase (aa449-462) Antibody

Sign In for Pricing
View Details
GLT8D4, CT (GXYLT2, GLT8D4, Glucoside xylosyltransferase 2, Glycosyltransferase 8 domain-containing protein 4) (Biotin) discontinued
036102-Biotin 200 µL

GLT8D4, CT (GXYLT2, GLT8D4, Glucoside xylosyltransferase 2, Glycosyltransferase 8 domain-containing protein 4) (Biotin) discontinued

Sign In for Pricing
View Details
Physics Ball Copper, Drill
1030666/2 1 Each

Physics Ball Copper, Drill

Sign In for Pricing
View Details
Anti-human Integrin a4b7 (Abrilumab Biosimilar)
BIO0406SM-20mg 20 mg

Anti-human Integrin a4b7 (Abrilumab Biosimilar)

Sign In for Pricing
View Details
Rabbit anti-Human Reelin polyclonal Antibody, Biotin conjugated
MBS1489838-01 0.05 mg

Rabbit anti-Human Reelin polyclonal Antibody, Biotin conjugated

Sign In for Pricing
View Details
Rabbit anti-Human Reelin polyclonal Antibody, Biotin conjugated
MBS1489838-02 0.1 mg

Rabbit anti-Human Reelin polyclonal Antibody, Biotin conjugated

Sign In for Pricing
View Details