What is the catalog number for KLK10 Recombinant Protein (Human)?

The catalog number for KLK10 Recombinant Protein (Human) is OPCA01007-100UG.

What sizes are available for KLK10 Recombinant Protein (Human)?

KLK10 Recombinant Protein (Human) is available in the following size(s): 100 µg.

Is KLK10 Recombinant Protein (Human) in stock?

KLK10 Recombinant Protein (Human) is currently made to order / not held in immediate stock. Contact us for lead time.

KLK10 Recombinant Protein (Human)

Product Specifications

CAS Number

9000-83-3

Gene Name

Kallikrein related peptidase 10

Gene Aliases

Breast normal epithelial cell associated serine protease; kallikrein 10 protein 1; kallikrein 10 protein 12; kallikrein 10 protein 13; kallikrein 10 protein 2; kallikrein 10 protein 3; kallikrein 10 protein 4; kallikrein 10 protein 5; kallikrein 10 protein 7; kallikrein 10 protein 8; kallikrein 10 protein 9; kallikrein-10; NES1; normal epithelial cell-specific 1; protease serine-like 1; PRSSL1.

Gene ID

5655

Reactivity

Homo sapiens|Human

Target

Has a tumor-suppressor role for NES1 in breast and prostate cancer.

Type

Protein

Source

E.coli

Sequence

AEAALLPQNDTRLDPEAYGSPCARGSQPWQVSLFNGLSFHCAGVLVDQSWVLTAAHCGNKPLWARVGDDHLLLLQGEQLRRTTRSVVHPKYHQGSGPILPRRTDEHDLMLLKLARPVVLGPRVRALQLPYRCAQPGDQCQVAGWGTTAARRVKYNKGLTCSSITILSPKECEVFYPGVVTNNMICAGLDRGQDPCQSDSGGPLVCDETLQGILSWGVYPCGSAQHPAVYTQICKYMSWINKVIR

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.