B7H4 Recombinant Protein (Human)

Product Specifications

CAS Number

9000-83-3

Gene Name

V-set domain containing T cell activation inhibitor 1

Gene Aliases

B7 family member, H4; B7 homolog 4; B7 superfamily member 1; B7h.5; B7H4; B7-H4; B7S1; B7X; immune costimulatory protein B7-H4; PRO1291; Protein B7S1; T cell costimulatory molecule B7x; T-cell costimulatory molecule B7x; VCTN1; V-set domain-containing T-cell activation inhibitor 1.

Gene ID

79679

Reactivity

Homo sapiens|Human

Target

Negatively regulates T-cell-mediated immune response by inhibiting T-cell activation, proliferation, cytokine production and development of cytotoxicity. When expressed on the cell surface of tumor macrophages, plays an important role, together with regulatory T-cells (Treg), in the suppression of tumor-associated antigen-specific T-cell immunity. Involved in promoting epithelial cell transformation.

Type

Protein

Source

E.coli

Sequence

IIGFGISGRHSITVTTVASAGNIGEDGILSCTFEPDIKLSDIVIQWLKEGVLGLVHEFKEGKDELSEQDEMFRGRTAVFADQVIVGNASLRLKNVQLTDAGTYKCYIITSKGKGNANLEYKTGAFSMPEVNVDYNASSETLRCEAPRWFPQPTVVWASQVDQGANFSEVSNTSFELNSENVTMKVVSVLYNVTINNTYSCMIENDIAKATGDIKVTESEIKRRSHLQLLNSKA

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

52.6 kDa

Protein Length

Recombinant

NCBI Gene Symbol

VTCN1

Protein Name

V-set domain-containing T-cell activation inhibitor 1

Gene Name URL

VTCN1

More Discoveries

Explore Other Products

Browse additional items from our catalog

MBS1013703-01 0.02 mg (E-Coli)

Recombinant Campylobacter jejuni subsp.jejuni serotype O:23/36 Translation initiation factor IF-3 (infC)

View Details

MBS1013703-02 0.1 mg (E-Coli)

Recombinant Campylobacter jejuni subsp.jejuni serotype O:23/36 Translation initiation factor IF-3 (infC)

View Details

MBS1013703-03 0.02 mg (Yeast)

Recombinant Campylobacter jejuni subsp.jejuni serotype O:23/36 Translation initiation factor IF-3 (infC)

View Details

MBS1013703-04 0.1 mg (Yeast)

Recombinant Campylobacter jejuni subsp.jejuni serotype O:23/36 Translation initiation factor IF-3 (infC)

View Details

MBS1013703-05 0.02 mg (Baculovirus)

Recombinant Campylobacter jejuni subsp.jejuni serotype O:23/36 Translation initiation factor IF-3 (infC)

View Details

MBS1013703-06 0.02 mg (Mammalian-Cell)

Recombinant Campylobacter jejuni subsp.jejuni serotype O:23/36 Translation initiation factor IF-3 (infC)

View Details