Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PYY Recombinant Protein (Human)

Product Specifications

CAS Number

9000-83-3

Gene Name

Peptide YY

Gene Aliases

Peptide tyrosine tyrosine; peptide YY; prepro-PYY; PYY1; PYY-I.

Gene ID

5697

Reactivity

Homo sapiens|Human

Target

This gut peptide inhibits exocrine pancreatic secretion, has a vasoconstrictory action and inhibitis jejunal and colonic mobility.

Type

Protein

Source

E.coli

Sequence

IKPEAPREDASPEELNRYYASLRHYLNLVTRQRY

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

8.1 kDa

Protein Length

Recombinant

NCBI Gene Symbol

PYY

Protein Name

Peptide YY

Gene Name URL

PYY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

METTL14 Protein Vector (Rat) (pPB-N-His)
PV281923 500 ng

METTL14 Protein Vector (Rat) (pPB-N-His)

Sign In for Pricing
View Details
Latexin, Recombinant, aa1-222, T7-Tag (LXN, Endogenous Carboxypeptidase Inhibitor, ECI, MUM, Tissue Carboxypeptidase Inhibitor, TCI)
149827 100 µg

Latexin, Recombinant, aa1-222, T7-Tag (LXN, Endogenous Carboxypeptidase Inhibitor, ECI, MUM, Tissue Carboxypeptidase Inhibitor, TCI)

Sign In for Pricing
View Details
Recombinant Saccharomyces cerevisiae Putative uncharacterized protein YJR018W (YJR018W)
MBS7039834-01 0.02 mg

Recombinant Saccharomyces cerevisiae Putative uncharacterized protein YJR018W (YJR018W)

Sign In for Pricing
View Details
Recombinant Saccharomyces cerevisiae Putative uncharacterized protein YJR018W (YJR018W)
MBS7039834-02 0.1 mg

Recombinant Saccharomyces cerevisiae Putative uncharacterized protein YJR018W (YJR018W)

Sign In for Pricing
View Details
Recombinant Saccharomyces cerevisiae Putative uncharacterized protein YJR018W (YJR018W)
MBS7039834-03 5x 0.1 mg

Recombinant Saccharomyces cerevisiae Putative uncharacterized protein YJR018W (YJR018W)

Sign In for Pricing
View Details
Raly 3'UTR Luciferase Stable Cell Line
TU117507 1.0 mL

Raly 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details