Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SPA17 Recombinant Protein (Human)

Product Specifications

CAS Number

9000-83-3

Gene Name

Sperm autoantigenic protein 17

Gene Aliases

Cancer/testis antigen 22; CT22; SP17; SP17-1; Sperm autoantigenic protein 17; sperm protein 17; sperm surface protein Sp17.

Gene ID

53340

Reactivity

Homo sapiens|Human

Target

Sperm surface zona pellucida binding protein. Helps to bind spermatozoa to the zona pellucida with high affinity. Might function in binding zona pellucida and carbohydrates (By similarity) .

Type

Protein

Source

E.coli

Sequence

MSIPFSNTHYRIPQGFGNLLEGLTREILREQPDNIPAFAAAYFESLLEKREKTNFDPAEWGSKVEDRFYNNHAFEEQEPPEKSDPKQEESQISGKEEETSVTILDSSEEDKEKEEVAAVKIQAAFRGHIAREEAKKMKTNSLQNEE

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

43.8 kDa

Protein Length

Recombinant

NCBI Gene Symbol

SPA17

Protein Name

Sperm surface protein Sp17

Gene Name URL

SPA17

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human HTT (Huntingtin) ELISA Kit
MBS8802435-01 48 Well

Human HTT (Huntingtin) ELISA Kit

Sign In for Pricing
View Details
Human HTT (Huntingtin) ELISA Kit
MBS8802435-02 96 Well

Human HTT (Huntingtin) ELISA Kit

Sign In for Pricing
View Details
Human HTT (Huntingtin) ELISA Kit
MBS8802435-03 5x 96 Well

Human HTT (Huntingtin) ELISA Kit

Sign In for Pricing
View Details
Human HTT (Huntingtin) ELISA Kit
MBS8802435-04 10x 96 Well

Human HTT (Huntingtin) ELISA Kit

Sign In for Pricing
View Details
RPSAP12 CRISPR Knock Out 293T Cell Line (Human)
42663141 1x 10^6 Cells / 1.0 mL

RPSAP12 CRISPR Knock Out 293T Cell Line (Human)

Sign In for Pricing
View Details
2,2-Diphenyl-1-picrylhydrazyl discontinued. See 159795
271180-01 1 g

2,2-Diphenyl-1-picrylhydrazyl discontinued. See 159795

Sign In for Pricing
View Details