Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant human Tumor necrosis factor alpha-induced protein 8

Product Specifications

CAS Number

9000-83-3

Gene Name

TNF alpha induced protein 8

Gene Aliases

GG2-1; head and neck tumor and metastasis-related protein; MDC-3.13; NDED; NF-kappa-B-inducible DED-containing protein; SCCS2; SCC-S2; TNF-induced protein GG2-1; tumor necrosis factor alpha-induced protein 8; tumor necrosis factor, alpha induced protein 8.

Gene ID

25816

Reactivity

Homo sapiens|Human

Target

Acts as a negative mediator of apoptosis and may play a role in tumor progression. Suppresses the TNF-mediated apoptosis by inhibiting caspase-8 activity but not the processing of procaspase-8, subsequently resulting in inhibition of BID cleavage and caspase-3 activation.

Type

Protein

Source

E.coli

Sequence

HSEAEESKEVATDVFNSKNLAVQAQKKILGKMVSKSIATTLIDDTSSEVLDELYRVTREYTQNKKEAEKIIKNLIKTVIKLAILYRNNQFNQDELALMEKFKKKVHQLAMTVVSFHQVDYTFDRNVLSRLLNECREMLHQIIQRHLTAKSHGRVNNVFDHFSDCEFLAALYNPFGNFKPHLQKLCDGINKMLDEENI

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

49.9 kDa

Protein Length

Recombinant

NCBI Gene Symbol

TNFAIP8

Protein Name

Tumor necrosis factor alpha-induced protein 8

Gene Name URL

TNFAIP8

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

L3MBTL Adenovirus (Human)
26251051 1.0 mL

L3MBTL Adenovirus (Human)

Sign In for Pricing
View Details
Tgfb2 sgRNA CRISPR Lentivector (Rat) (Target 3)
K7044704 1.0 µg DNA

Tgfb2 sgRNA CRISPR Lentivector (Rat) (Target 3)

Sign In for Pricing
View Details
Recombinant Human Brain and Acute Leukemia, Cytoplamatic
MBS556293-01 0.002 mg

Recombinant Human Brain and Acute Leukemia, Cytoplamatic

Sign In for Pricing
View Details
Recombinant Human Brain and Acute Leukemia, Cytoplamatic
MBS556293-02 0.1 mg

Recombinant Human Brain and Acute Leukemia, Cytoplamatic

Sign In for Pricing
View Details
Recombinant Human Brain and Acute Leukemia, Cytoplamatic
MBS556293-03 5x 0.01 mg

Recombinant Human Brain and Acute Leukemia, Cytoplamatic

Sign In for Pricing
View Details
Phospho-RAC1 (Ser71) Antibody
MBS7132883-01 0.1 mL

Phospho-RAC1 (Ser71) Antibody

Sign In for Pricing
View Details