What is the catalog number for TIMP3 Recombinant Protein (Human)?

The catalog number for TIMP3 Recombinant Protein (Human) is OPCA00938-1MG.

What sizes are available for TIMP3 Recombinant Protein (Human)?

TIMP3 Recombinant Protein (Human) is available in the following size(s): 1 mg.

Is TIMP3 Recombinant Protein (Human) in stock?

TIMP3 Recombinant Protein (Human) is currently made to order / not held in immediate stock. Contact us for lead time.

TIMP3 Recombinant Protein (Human)

Product Specifications

CAS Number

9000-83-3

Gene Name

TIMP metallopeptidase inhibitor 3

Gene Aliases

HSMRK222; K222; K222TA2; metalloproteinase inhibitor 3; MIG-5 protein; protein MIG-5; SFD; TIMP-3; tissue inhibitor of metalloproteinases 3.

Gene ID

7078

Reactivity

Homo sapiens|Human

Target

Complexes with metalloproteinases (such as collagenases) and irreversibly inactivates them by binding to their catalytic zinc cofactor. May form part of a tissue-specific acute response to remodeling stimuli. Known to act on MMP-1, MMP-2, MMP-3, MMP-7, MMP-9, MMP-13, MMP-14 and MMP-15.

Type

Protein

Source

E.coli

Sequence

HPQDAFCNSDIVIRAKVVGKKLVKEGPFGTLVYTIKQMKMYRGFTKMPHVQYIHTEASESLCGLKLEVNKYQYLLTGRVYDGKMYTGLCNFVERWDQLTLSQRKGLNYRYHLGCNCKIKSCYYLPCFVTSKNECLWTDMLSNFGYPGYQSKHYACIRQKGGYCSWYRGWAPPDKSIINA

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol._x005F If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.