Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant human Bis (5'-adenosyl) -triphosphatase

Product Specifications

CAS Number

9000-83-3

Gene Name

Fragile histidine triad diadenosine triphosphatase

Gene Aliases

AP3A hydrolase; AP3Aase; bis (5'-adenosyl) -triphosphatase; diadenosine 5',5'''-P1, P3-triphosphate hydrolase; dinucleosidetriphosphatase; FRA3B; Fragile histidine triad protein.

Gene ID

2272

Reactivity

Homo sapiens|Human

Target

Cleaves P (1) -P (3) -bis (5'-adenosyl) triphosphate (Ap3A) to yield AMP and ADP. Can also hydrolyze P (1) -P (4) -bis (5'-adenosyl) tetraphosphate (Ap4A), but has extremely low activity with ATP. Modulates transcriptional activation by CTNNB1 and thereby contributes to regulate the expression of genes essential for cell proliferation and survival, such as CCND1 and BIRC5. Plays a role in the induction of apoptosis via SRC and AKT1 signaling pathways. Inhibits MDM2-mediated proteasomal degradation of p53/TP53 and thereby plays a role in p53/TP53-mediated apoptosis. Induction of apoptosis depends on the ability of FHIT to bind P (1) -P (3) -bis (5'-adenosyl) triphosphate or related compounds, but does not require its catalytic activity, it may in part come from the mitochondrial form, which sensitizes the low-affinity Ca (2+) transporters, enhancing mitochondrial calcium uptake. Functions as tumor suppressor.

Type

Protein

Source

E.coli

Sequence

SFRFGQHLIKPSVVFLKTELSFALVNRKPVVPGHVLVCPLRPVERFHDLRPDEVADLFQTTQRVGTVVEKHFHGTSLTFSMQDGPEAGQTVKHVHVHVLPRKAGDFHRNDSIYEELQKHDKEDFPASWRSEEEMAAEAAALRVYFQ

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

20.7 kDa

Protein Length

Recombinant

NCBI Gene Symbol

FHIT

Protein Name

Bis (5'-adenosyl) -triphosphatase

Gene Name URL

FHIT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HOX11 (TLX1) (NM_005521) Human Tagged ORF Clone Lentiviral Particle
RC224215L3V 200 µL

HOX11 (TLX1) (NM_005521) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Myc tag Monoclonal Antibody, PE-Cy5.5 Conjugated
bsm-33024M-PE-Cy5.5 100 µL

Myc tag Monoclonal Antibody, PE-Cy5.5 Conjugated

Sign In for Pricing
View Details
Rassf7 (NM_025886) Mouse Tagged Lenti ORF Clone
MR205353L3 10 µg

Rassf7 (NM_025886) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Rabbit Anti AGR2 Polyclonal Affinity Purified (PBS with 0.05% sodium azide and 50% glycerol, pH7.4)(Western Blot, ELISA)
MBS8422282-01 0.001 mL

Rabbit Anti AGR2 Polyclonal Affinity Purified (PBS with 0.05% sodium azide and 50% glycerol, pH7.4)(Western Blot, ELISA)

Sign In for Pricing
View Details
Rabbit Anti AGR2 Polyclonal Affinity Purified (PBS with 0.05% sodium azide and 50% glycerol, pH7.4)(Western Blot, ELISA)
MBS8422282-02 5x 0.001 mL

Rabbit Anti AGR2 Polyclonal Affinity Purified (PBS with 0.05% sodium azide and 50% glycerol, pH7.4)(Western Blot, ELISA)

Sign In for Pricing
View Details
Pilocarpine HCl
S4231-50mg 50 mg

Pilocarpine HCl

Sign In for Pricing
View Details