Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant human Bis (5'-adenosyl) -triphosphatase

Product Specifications

CAS Number

9000-83-3

Gene Name

Fragile histidine triad diadenosine triphosphatase

Gene Aliases

AP3A hydrolase; AP3Aase; bis (5'-adenosyl) -triphosphatase; diadenosine 5',5'''-P1, P3-triphosphate hydrolase; dinucleosidetriphosphatase; FRA3B; Fragile histidine triad protein.

Gene ID

2272

Reactivity

Homo sapiens|Human

Target

Cleaves P (1) -P (3) -bis (5'-adenosyl) triphosphate (Ap3A) to yield AMP and ADP. Can also hydrolyze P (1) -P (4) -bis (5'-adenosyl) tetraphosphate (Ap4A), but has extremely low activity with ATP. Modulates transcriptional activation by CTNNB1 and thereby contributes to regulate the expression of genes essential for cell proliferation and survival, such as CCND1 and BIRC5. Plays a role in the induction of apoptosis via SRC and AKT1 signaling pathways. Inhibits MDM2-mediated proteasomal degradation of p53/TP53 and thereby plays a role in p53/TP53-mediated apoptosis. Induction of apoptosis depends on the ability of FHIT to bind P (1) -P (3) -bis (5'-adenosyl) triphosphate or related compounds, but does not require its catalytic activity, it may in part come from the mitochondrial form, which sensitizes the low-affinity Ca (2+) transporters, enhancing mitochondrial calcium uptake. Functions as tumor suppressor.

Type

Protein

Source

E.coli

Sequence

SFRFGQHLIKPSVVFLKTELSFALVNRKPVVPGHVLVCPLRPVERFHDLRPDEVADLFQTTQRVGTVVEKHFHGTSLTFSMQDGPEAGQTVKHVHVHVLPRKAGDFHRNDSIYEELQKHDKEDFPASWRSEEEMAAEAAALRVYFQ

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

20.7 kDa

Protein Length

Recombinant

NCBI Gene Symbol

FHIT

Protein Name

Bis (5'-adenosyl) -triphosphatase

Gene Name URL

FHIT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Mprip shRNA (UAS) - Lentiviral mouse Mprip shRNA (UAS, iRFP) plasmid
GTR15145396 1 Vial

Lentiviral mouse Mprip shRNA (UAS) - Lentiviral mouse Mprip shRNA (UAS, iRFP) plasmid

Sign In for Pricing
View Details
PRRX2 (Paired Mesoderm Homeobox Protein 2, Paired-related Homeobox Protein 2, PMX2, PRX2, PRX-2)
131897 50 µg

PRRX2 (Paired Mesoderm Homeobox Protein 2, Paired-related Homeobox Protein 2, PMX2, PRX2, PRX-2)

Sign In for Pricing
View Details
Krt82 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)
K4052007 1.0 µg DNA

Krt82 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details
Rabbit Anti-Mouse IgG-Fc Antibody, HRP Conjugated
bs-0377R-HRP 200 µL

Rabbit Anti-Mouse IgG-Fc Antibody, HRP Conjugated

Sign In for Pricing
View Details
CYP1A2 (Cytochrome P450, Family 1, Subfamily A, Polypeptide 2, CP12, P3-450, P450(PA)) (MaxLight 490)
MBS6205813-01 0.1 mL

CYP1A2 (Cytochrome P450, Family 1, Subfamily A, Polypeptide 2, CP12, P3-450, P450(PA)) (MaxLight 490)

Sign In for Pricing
View Details
CYP1A2 (Cytochrome P450, Family 1, Subfamily A, Polypeptide 2, CP12, P3-450, P450(PA)) (MaxLight 490)
MBS6205813-02 5x 0.1 mL

CYP1A2 (Cytochrome P450, Family 1, Subfamily A, Polypeptide 2, CP12, P3-450, P450(PA)) (MaxLight 490)

Sign In for Pricing
View Details