Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

COL4A1 Recombinant Protein (Human)

Product Specifications

CAS Number

9000-83-3

Gene Name

Collagen type IV alpha 1 chain

Gene Aliases

Arresten; BSVD; BSVD1; COL4A1 NC1 domain; COL4A1s; collagen alpha-1 (IV) chain; collagen IV, alpha-1 polypeptide; collagen of basement membrane, alpha-1 chain; PADMAL; RATOR.

Gene ID

1282

Reactivity

Homo sapiens|Human

Target

Type IV collagen is the major structural component of glomerular basement membranes (GBM), forming a 'chicken-wire' meshwork together with laminins, proteoglycans and entactin/nidogen.

Type

Protein

Source

E.coli

Sequence

GCAGSGCGKCDCHGVKGQKGERGLPGLQGVIGFPGMQGPEGPQGPPGQKGDTGEPGLPGTKGTRGPPGASGYPGNPGLPGIPGQDGPPGPPGIPGCNGTKGERGPLGPPGLPGFAGNPGPPGLPGMKGDPGEILGHVP

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

39.9 kDa

Protein Length

Recombinant

NCBI Gene Symbol

COL4A1

Protein Name

Collagen alpha-1 (IV) chain

Gene Name URL

COL4A1

More Discoveries

Explore Other Products

Browse additional items from our catalog

B7-2 Recombinant Protein His Tag Lyophilized 100UG
IB72RHISLY100UG 100 µg

B7-2 Recombinant Protein His Tag Lyophilized 100UG

Sign In for Pricing
View Details
Depdc1b ORF Vector (Mouse) (pORF)
ORF042928 1.0 µg DNA

Depdc1b ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
NECTIN4 Antibody, FITC conjugated
MBS7109350-01 0.05 mg

NECTIN4 Antibody, FITC conjugated

Sign In for Pricing
View Details
NECTIN4 Antibody, FITC conjugated
MBS7109350-02 0.1 mg

NECTIN4 Antibody, FITC conjugated

Sign In for Pricing
View Details
NECTIN4 Antibody, FITC conjugated
MBS7109350-03 5x 0.1 mg

NECTIN4 Antibody, FITC conjugated

Sign In for Pricing
View Details
Anti-ATF-6 Polyclonal Antibody 2
TMAB-00161-01 50 μL

Anti-ATF-6 Polyclonal Antibody 2

Sign In for Pricing
View Details