Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant human Heat shock 70 kDa protein 13

Product Specifications

CAS Number

9000-83-3

Gene Name

Heat shock protein family A (Hsp70) member 13

Gene Aliases

Heat shock 70 kDa protein 13; heat shock protein 70kDa family, member 13; microsomal stress 70 protein ATPase core; Microsomal stress-70 protein ATPase core; STCH; stress 70 protein chaperone, microsome-associated, 60kD; stress 70 protein chaperone, microsome-associated, 60kDa; stress-70 protein chaperone microsome-associated 60 kDa protein; testis secretory sperm-binding protein Li 199a.

Gene ID

6782

Reactivity

Homo sapiens|Human

Target

Has peptide-independent ATPase activity.

Type

Protein

Source

E.coli

Sequence

QQYLPLPTPKVIGIDLGTTYCSVGVFFPGTGKVKVIPDENGHISIPSMVSFTDNDVYVGYESVELADSNPQNTIYDAKRFIGKIFTAEELEAEIGRYPFKVLNKNGMVEFSVTSNETITVSPEYVGSRLLLKLKEMAEAYLGMPVANAVISVPAEFDLKQRNSTIEAANLAGLKILRVINEPTAAAMAYGLHKADVFHVLVIDLGGGTLDVSLLNKQGGMFLTRAMSGNNKLGGQDFNQRLLQYLYKQIYQTYGFVPSRKEEIHRLRQAVEMVKLNLTLHQSAQLSVLLTVEEQDRKEPHSSDTELPKDKLSSADDHRVNSGFGRGLSDKKSGESQVLFETEISRKLFDTLNEDLFQKILVPIQQVLKEGHLEKTEIDEVVLVGGSTRIPRIRQVIQEFFGKDPNTSVDPDLAVVTGVAIQAGIDGGSWPLQVSALEIPNKHLQKTNFN

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

76.6 kDa

Protein Length

Recombinant

NCBI Gene Symbol

HSPA13

Protein Name

Heat shock 70 kDa protein 13

Gene Name URL

HSPA13

More Discoveries

Explore Other Products

Browse additional items from our catalog

PAFAH2, ID (PAFAH2, Platelet-activating factor acetylhydrolase 2, cytoplasmic, Serine-dependent phospholipase A2)
039613 200 µL

PAFAH2, ID (PAFAH2, Platelet-activating factor acetylhydrolase 2, cytoplasmic, Serine-dependent phospholipase A2)

Sign In for Pricing
View Details
Mouse Pdzd7 Pre-designed siRNA Set A
SI110350A 1 Each

Mouse Pdzd7 Pre-designed siRNA Set A

Sign In for Pricing
View Details
Human Histone H4 (H4) ELISA Kit
RDR-H4-Hu-48Tests 48 Tests

Human Histone H4 (H4) ELISA Kit

Sign In for Pricing
View Details
Mouse LPPR4 siRNA
abx922784-01 15 nmol

Mouse LPPR4 siRNA

Sign In for Pricing
View Details
Mouse LPPR4 siRNA
abx922784-02 30 nmol

Mouse LPPR4 siRNA

Sign In for Pricing
View Details
IARS polyclonal antibody
BS70334-01 50 µL

IARS polyclonal antibody

Sign In for Pricing
View Details