What is the catalog number for TDGF1 Recombinant Protein (Human)?

The catalog number for TDGF1 Recombinant Protein (Human) is OPCA00890-1MG.

What sizes are available for TDGF1 Recombinant Protein (Human)?

TDGF1 Recombinant Protein (Human) is available in the following size(s): 1 mg.

Is TDGF1 Recombinant Protein (Human) in stock?

TDGF1 Recombinant Protein (Human) is currently made to order / not held in immediate stock. Contact us for lead time.

TDGF1 Recombinant Protein (Human)

Product Specifications

CAS Number

9000-83-3

Gene Name

Teratocarcinoma-derived growth factor 1

Gene Aliases

CR; CR-1; CRGF; CRIPTO; cripto-1 growth factor; epidermal growth factor-like cripto protein CR1; teratocarcinoma-derived growth factor 1.

Gene ID

6997

Reactivity

Homo sapiens|Human

Target

GPI-anchored cell membrane protein involved in Nodal signaling. Cell-associated TDGF1 acts as a Nodal coreceptor in cis. Shedding of TDGF1 by TMEM8A modulates Nodal signaling by allowing soluble TDGF1 to act as a Nodal coreceptor on other cells (PubMed:27881714) . Could play a role in the determination of the epiblastic cells that subsequently give rise to the mesoderm (PubMed:11909953) .

Type

Protein

Source

E.coli

Sequence

GHQEFARPSRGYLAFRDDSIWPQEEPAIRPRSSQRVPPMGIQHSKELNRTCCLNGGTCMLGSFCACPPSFYGRNCEHDVRKENCGSVPHDTWLPKKCSLCKCWHGQLRCFPQAFLPGCD

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.