Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CTSS Recombinant Protein (Human)

Product Specifications

CAS Number

9000-83-3

Gene Name

Cathepsin S

Gene Aliases

Cathepsin S.

Gene ID

1520

Reactivity

Homo sapiens|Human

Target

Thiol protease. Key protease responsible for the removal of the invariant chain from MHC class II molecules. The bond-specificity of this proteinase is in part similar to the specificities of cathepsin L.

Type

Protein

Source

E.coli

Sequence

LPDSVDWREKGCVTEVKYQGSCGACWAFSAVGALEAQLKLKTGKLVSLSAQNLVDCSTEKYGNKGCNGGFMTTAFQYIIDNKGIDSDASYPYKAMDQKCQYDSKYRAATCSKYTELPYGREDVLKEAVANKGPVSVGVDARHPSFFLYRSGVYYEPSCTQNVNHGVLVVGYGDLNGKEYWLVKNSWGHNFGEEGYIRMARNKGNHCGIASFPSYPEI

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

28 kDa

Protein Length

Recombinant

NCBI Gene Symbol

CTSS

Protein Name

Cathepsin S

Gene Name URL

CTSS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C22orf43 Protein Vector (Human) (pPB-His-GST)
PV330659 500 ng

C22orf43 Protein Vector (Human) (pPB-His-GST)

Sign In for Pricing
View Details
ALK Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1D7]
TA800796BM 100 µL

ALK Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1D7]

Sign In for Pricing
View Details
ALDH3B2 (NM_000695) Human Over-expression Lysate
LY424565 100 µg

ALDH3B2 (NM_000695) Human Over-expression Lysate

Sign In for Pricing
View Details
α-parvin Double Nickase Plasmid (m2)
sc-425386-NIC-2 20 µg

α-parvin Double Nickase Plasmid (m2)

Sign In for Pricing
View Details
Rabbit MAT ELISA Kit
ERTM0241 96 Tests

Rabbit MAT ELISA Kit

Sign In for Pricing
View Details
PDGFRA Antibody HRP Conjugated
MBS9459824-01 0.1 mL

PDGFRA Antibody HRP Conjugated

Sign In for Pricing
View Details