Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GOLM1 Recombinant Protein (Human)

Product Specifications

CAS Number

9000-83-3

Gene Name

Golgi membrane protein 1

Gene Aliases

BA379P1.3; C9orf155; epididymis luminal protein 46; Golgi membrane protein 1; golgi membrane protein GP73; golgi phosphoprotein 2; golgi protein, 73-kD; GOLPH2; GP73; HEL46; PSEC0257.

Gene ID

51280

Reactivity

Homo sapiens|Human

Target

Unknown. Cellular response protein to viral infection.

Type

Protein

Source

E.coli

Sequence

SSRSVDLQTRIMELEGRVRRAAAERGAVELKKNEFQGELEKQREQLDKIQSSHNFQLESVNKLYQDEKAVLVNNITTGERLIRVLQDQLKTLQRNYGRLQQDVLQFQKNQTNLERKFSYDLSQCINQMKEVKEQCEERIEEVTKKGNEAVASRDLSENNDQRQQLQALSEPQPRLQAAGLPHTEVPQGKGNVLGNSKSQTPAPSSEVVLDSKRQVEKEETNEIQVVNEEPQRDRLPQEPGREQVVEDRPVGGRGFGGAGELGQTPQVQAALSVSQENPEMEGPERDQLVIPDGQEEEQEAAGEGRNQQKLRGEDDYNMDENEAESETDKQAALAGNDRNIDVFNVEDQKRDTINLLDQREKRNHTL

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

45.6 kDa

Protein Length

Recombinant

NCBI Gene Symbol

GOLM1

Protein Name

Golgi membrane protein 1

Gene Name URL

GOLM1

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human NRG1 shRNA (UAS) - Lentiviral human NRG1 shRNA (UAS, iRFP) (100)
GTR15079131 1 Vial

Lentiviral human NRG1 shRNA (UAS) - Lentiviral human NRG1 shRNA (UAS, iRFP) (100)

Sign In for Pricing
View Details
FAM176A Blocking peptide
orb1451560 500 µg

FAM176A Blocking peptide

Sign In for Pricing
View Details
PowderThief Body 2000mm
SAM1015 1 Each

PowderThief Body 2000mm

Sign In for Pricing
View Details
Human Adiponectin ELISA KIT
E16HE0021-048 48 wells

Human Adiponectin ELISA KIT

Sign In for Pricing
View Details
alpha-1 antitrypsin fragment
A1051-10 10 mg

alpha-1 antitrypsin fragment

Sign In for Pricing
View Details
Mouse Monoclonal CRISPR-Cas9 Antibody (6G12) [Allophycocyanin]
NBP2-52398APC 0.1 mL

Mouse Monoclonal CRISPR-Cas9 Antibody (6G12) [Allophycocyanin]

Sign In for Pricing
View Details