Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GOLM1 Recombinant Protein (Human)

Product Specifications

CAS Number

9000-83-3

Gene Name

Golgi membrane protein 1

Gene Aliases

BA379P1.3; C9orf155; epididymis luminal protein 46; Golgi membrane protein 1; golgi membrane protein GP73; golgi phosphoprotein 2; golgi protein, 73-kD; GOLPH2; GP73; HEL46; PSEC0257.

Gene ID

51280

Reactivity

Homo sapiens|Human

Target

Unknown. Cellular response protein to viral infection.

Type

Protein

Source

E.coli

Sequence

SSRSVDLQTRIMELEGRVRRAAAERGAVELKKNEFQGELEKQREQLDKIQSSHNFQLESVNKLYQDEKAVLVNNITTGERLIRVLQDQLKTLQRNYGRLQQDVLQFQKNQTNLERKFSYDLSQCINQMKEVKEQCEERIEEVTKKGNEAVASRDLSENNDQRQQLQALSEPQPRLQAAGLPHTEVPQGKGNVLGNSKSQTPAPSSEVVLDSKRQVEKEETNEIQVVNEEPQRDRLPQEPGREQVVEDRPVGGRGFGGAGELGQTPQVQAALSVSQENPEMEGPERDQLVIPDGQEEEQEAAGEGRNQQKLRGEDDYNMDENEAESETDKQAALAGNDRNIDVFNVEDQKRDTINLLDQREKRNHTL

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

45.6 kDa

Protein Length

Recombinant

NCBI Gene Symbol

GOLM1

Protein Name

Golgi membrane protein 1

Gene Name URL

GOLM1

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Azoarcus sp. Histidine--tRNA ligase (hisS)
MBS1192897-01 0.02 mg (E-Coli)

Recombinant Azoarcus sp. Histidine--tRNA ligase (hisS)

Sign In for Pricing
View Details
Recombinant Azoarcus sp. Histidine--tRNA ligase (hisS)
MBS1192897-02 0.02 mg (Yeast)

Recombinant Azoarcus sp. Histidine--tRNA ligase (hisS)

Sign In for Pricing
View Details
Recombinant Azoarcus sp. Histidine--tRNA ligase (hisS)
MBS1192897-03 0.1 mg (E-Coli)

Recombinant Azoarcus sp. Histidine--tRNA ligase (hisS)

Sign In for Pricing
View Details
Recombinant Azoarcus sp. Histidine--tRNA ligase (hisS)
MBS1192897-04 0.1 mg (Yeast)

Recombinant Azoarcus sp. Histidine--tRNA ligase (hisS)

Sign In for Pricing
View Details
Recombinant Azoarcus sp. Histidine--tRNA ligase (hisS)
MBS1192897-05 0.02 mg (Baculovirus)

Recombinant Azoarcus sp. Histidine--tRNA ligase (hisS)

Sign In for Pricing
View Details
Recombinant Azoarcus sp. Histidine--tRNA ligase (hisS)
MBS1192897-06 0.02 mg (Mammalian-Cell)

Recombinant Azoarcus sp. Histidine--tRNA ligase (hisS)

Sign In for Pricing
View Details