Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ANGPTL4 Recombinant Protein (Human)

Product Specifications

CAS Number

9000-83-3

Gene Name

Angiopoietin like 4

Gene Aliases

Angiopoietin-like protein 4; angiopoietin-related protein 4; ARP4; fasting-induced adipose factor; FIAF; HARP; hepatic angiopoietin-related protein; hepatic fibrinogen/angiopoietin-related protein; HFARP; NL2; peroxisome proliferator-activated receptor (PPAR) gamma induced angiopoietin-related protein; PGAR; pp1158; PPARG angiopoietin related protein; TGQTL; UNQ171.

Gene ID

51129

Reactivity

Homo sapiens|Human

Target

Protein with hypoxia-induced expression in endothelial cells. May act as a regulator of angiogenesis and modulate tumorigenesis. Inhibits proliferation, migration, and tubule formation of endothelial cells and reduces vascular leakage. May exert a protective function on endothelial cells through an endocrine action. It is directly involved in regulating glucose homeostasis, lipid metabolism, and insulin sensitivity. In response to hypoxia, the unprocessed form of the protein accumulates in the subendothelial extracellular matrix (ECM) . The matrix-associated and immobilized unprocessed form limits the formation of actin stress fibers and focal contacts in the adhering endothelial cells and inhibits their adhesion. It also decreases motility of endothelial cells and inhibits the sprouting and tube formation (By similarity) .

Type

Protein

Source

E.coli

Sequence

VQSKSPRFASWDEMNVLAHGLLQLGQGLREHAERTRSQLSALERRLSACGSACQGTEGSTDLPLAPESRVDPEVLHSLQTQLKAQNSRIQQLFHKVAQQQRHLEKQHLRIQHLQSQFGLLDHKHLDHEVAKPARRKRLPEMAQPVDPAHNVSRLHRLPRDCQELFQVGERQSGLFEIQPQGSPPFLVNCKMTSDGGWTVIQRRHDGSVDFNRPWEAYKAGFGDPHGEFWLGLEKVHSITGDRNSRLAVQLRDWDGNAELLQFSVHLGGEDTAYSLQLTAPVAGQLGATTVPPSGLSVPFSTWDQDHDLRRDKNCAKSLSGGWWFGTCSHSNLNGQYFRSIPQQRQKLKKGIFWKTWRGRYYPLQATTMLIQPMAAE

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

69.6 kDa

Protein Length

Recombinant

NCBI Gene Symbol

ANGPTL4

Protein Name

Angiopoietin-related protein 4

Gene Name URL

ANGPTL4

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Vmn1r179 Protein Lysate (Mouse) with C-HA Tag
49583034 100 µg

Vmn1r179 Protein Lysate (Mouse) with C-HA Tag

Ask
View Details
Cat Transmembrane Protein 219 (TMEM219) ELISA Kit
MBS9361425 Inquire

Cat Transmembrane Protein 219 (TMEM219) ELISA Kit

Ask
View Details
Recombinant Burkholderia cenocepacia Maf-like protein Bcen_0637 (Bcen_0637)
MBS1406876-01 0.02 mg (E-Coli)

Recombinant Burkholderia cenocepacia Maf-like protein Bcen_0637 (Bcen_0637)

Ask
View Details
Recombinant Burkholderia cenocepacia Maf-like protein Bcen_0637 (Bcen_0637)
MBS1406876-02 0.1 mg (E-Coli)

Recombinant Burkholderia cenocepacia Maf-like protein Bcen_0637 (Bcen_0637)

Ask
View Details
Recombinant Burkholderia cenocepacia Maf-like protein Bcen_0637 (Bcen_0637)
MBS1406876-03 0.02 mg (Yeast)

Recombinant Burkholderia cenocepacia Maf-like protein Bcen_0637 (Bcen_0637)

Ask
View Details
Recombinant Burkholderia cenocepacia Maf-like protein Bcen_0637 (Bcen_0637)
MBS1406876-04 0.1 mg (Yeast)

Recombinant Burkholderia cenocepacia Maf-like protein Bcen_0637 (Bcen_0637)

Ask
View Details