What sizes are available for Recombinant human Creatine kinase U-type, mitochondrial?

Recombinant human Creatine kinase U-type, mitochondrial is available in the following size(s): 20 µg.

Recombinant human Creatine kinase U-type, mitochondrial

Q: What is the catalog number for Recombinant human Creatine kinase U-type, mitochondrial?

The catalog number for Recombinant human Creatine kinase U-type, mitochondrial is OPCA00847-20UG.

Q: Is Recombinant human Creatine kinase U-type, mitochondrial in stock?

Recombinant human Creatine kinase U-type, mitochondrial is currently made to order / not held in immediate stock. Contact us for lead time.

Product Specifications

CAS Number

9000-83-3

Gene Name

Creatine kinase, mitochondrial 1A|creatine kinase, mitochondrial 1B

Gene Aliases

Acidic-type mitochondrial creatine kinase; CKMT; CKMT1; creatine kinase U-type, mitochondrial; creatine kinase, mitochondrial 1 (ubiquitous) ; mia-CK; ubiquitous mitochondrial creatine kinase; U-MtCK; UMTCK.

Gene ID

1159|548596

Reactivity

Homo sapiens|Human

Target

Reversibly catalyzes the transfer of phosphate between ATP and various phosphogens (e.g. creatine phosphate) . Creatine kinase isoenzymes play a central role in energy transduction in tissues with large, fluctuating energy demands, such as skeletal muscle, heart, brain and spermatozoa.

Type

Protein

Source

E.coli

Sequence

ASERRRLYPPSAEYPDLRKHNNCMASHLTPAVYARLCDKTTPTGWTLDQCIQTGVDNPGHPFIKTVGMVAGDEETYEVFADLFDPVIQERHNGYDPRTMKHTTDLDASKIRSGYFDERYVLSSRVRTGRSIRGLSLPPACTRAERREVERVVVDALSGLKGDLAGRYYRLSEMTEAEQQQLIDDHFLFDKPVSPLLTAAGMARDWPDARGIWHNNEKSFLIWVNEEDHTRVISMEKGGNMKRVFERFCRGLKEVERLIQERGWEFMWNERLGYILTCPSNLGTGLRAGVHIKLPLLSKDSRFPKILENLRLQKRGTGGVDTAATGGVFDISNLDRLGKSEVELVQLVIDGVNYLIDCERRLERGQDIRIPTPVIHTKH

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.