Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LGALS7 Recombinant Protein (Human)

Product Specifications

CAS Number

9000-83-3

Gene Name

Galectin 7|galectin 7B

Gene Aliases

Gal-7; GAL7; galectin-7; HKL-14; keratinocyte lectin 14; lectin galactoside-binding soluble 7; lectin, galactoside-binding, soluble, 7; lectin, galactoside-binding, soluble, 7B; LGALS7; LGALS7A; p53-induced gene 1 protein; p53-induced protein 1; PI7.

Gene ID

3963|653499

Reactivity

Homo sapiens|Human

Target

Could be involved in cell-cell and/or cell-matrix interactions necessary for normal growth control. Pro-apoptotic protein that functions intracellularly upstream of JNK activation and cytochrome c release.

Type

Protein

Source

E.coli

Sequence

SNVPHKSSLPEGIRPGTVLRIRGLVPPNASRFHVNLLCGEEQGSDAALHFNPRLDTSEVVFNSKEQGSWGREERGPGVPFQRGQPFEVLIIASDDGFKAVVGDAQYHHFRHRLPLARVRLVEVGGDVQLDSVRIF

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

18.9 kDa

Protein Length

Recombinant

NCBI Gene Symbol

LGALS7|LGALS7B

Protein Name

Galectin-7

Gene Name URL

LGALS7|LGALS7B

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TRPM7 Recombinant Antibody, AbBy Fluor™ 405 Conjugated
bsm-61679R-BF405-01 20 µL

TRPM7 Recombinant Antibody, AbBy Fluor™ 405 Conjugated

Sign In for Pricing
View Details
TRPM7 Recombinant Antibody, AbBy Fluor™ 405 Conjugated
bsm-61679R-BF405-02 100 µL

TRPM7 Recombinant Antibody, AbBy Fluor™ 405 Conjugated

Sign In for Pricing
View Details
XIAP Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)
LV695407 1.0 µg DNA

XIAP Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
Human Filamin B Beta (FLNb) Antibody Pair Kit (with Standard)
MBS2103238-01 5x 96 Tests

Human Filamin B Beta (FLNb) Antibody Pair Kit (with Standard)

Sign In for Pricing
View Details
Human Filamin B Beta (FLNb) Antibody Pair Kit (with Standard)
MBS2103238-02 5x 96 Tests + MBS2090685 (Ab Pairs Support Pack 1,5x 96 Tests)

Human Filamin B Beta (FLNb) Antibody Pair Kit (with Standard)

Sign In for Pricing
View Details
Human Filamin B Beta (FLNb) Antibody Pair Kit (with Standard)
MBS2103238-03 10x 96 Tests

Human Filamin B Beta (FLNb) Antibody Pair Kit (with Standard)

Sign In for Pricing
View Details