What is the catalog number for LGALS7 Recombinant Protein (Human)?

The catalog number for LGALS7 Recombinant Protein (Human) is OPCA00832-100UG.

What sizes are available for LGALS7 Recombinant Protein (Human)?

LGALS7 Recombinant Protein (Human) is available in the following size(s): 100 µg.

Is LGALS7 Recombinant Protein (Human) in stock?

LGALS7 Recombinant Protein (Human) is currently made to order / not held in immediate stock. Contact us for lead time.

LGALS7 Recombinant Protein (Human)

Product Specifications

CAS Number

9000-83-3

Gene Name

Galectin 7|galectin 7B

Gene Aliases

Gal-7; GAL7; galectin-7; HKL-14; keratinocyte lectin 14; lectin galactoside-binding soluble 7; lectin, galactoside-binding, soluble, 7; lectin, galactoside-binding, soluble, 7B; LGALS7; LGALS7A; p53-induced gene 1 protein; p53-induced protein 1; PI7.

Gene ID

3963|653499

Reactivity

Homo sapiens|Human

Target

Could be involved in cell-cell and/or cell-matrix interactions necessary for normal growth control. Pro-apoptotic protein that functions intracellularly upstream of JNK activation and cytochrome c release.

Type

Protein

Source

E.coli

Sequence

SNVPHKSSLPEGIRPGTVLRIRGLVPPNASRFHVNLLCGEEQGSDAALHFNPRLDTSEVVFNSKEQGSWGREERGPGVPFQRGQPFEVLIIASDDGFKAVVGDAQYHHFRHRLPLARVRLVEVGGDVQLDSVRIF

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.