Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant human Lymphotactin protein

Product Specifications

CAS Number

9000-83-3

Gene Name

X-C motif chemokine ligand 1

Gene Aliases

ATAC; c motif chemokine 1; chemokine (C motif) ligand 1; cytokine SCM-1; LPTN; LTN; lymphotactin; lymphotaxin; SCM1; SCM-1; SCM-1a; SCM1A; SCM-1-alpha; SCYC1; single cysteine motif 1a; small inducible cytokine subfamily C, member 1 (lymphotactin) ; small-inducible cytokine C1; XC chemokine ligand 1.

Gene ID

6375

Reactivity

Homo sapiens|Human

Target

Chemotactic activity for lymphocytes but not for monocytes or neutrophils. In thymus, mediates medullary accumulation of thymic dendritic cells and contributes to regulatoy T cell development, playing a role in self-tolerance establishment.

Type

Protein

Source

E.coli

Sequence

VGSEVSDKRTCVSLTTQRLPVSRIKTYTITEGSLRAVIFITKRGLKVCADPQATWVRDVVRSMDRKSNTRNNMIQTKPTGTQQSTNTAVTLTG

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

14.3 kDa

Protein Length

Recombinant

NCBI Gene Symbol

XCL1

Protein Name

Lymphotactin

Gene Name URL

XCL1

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GAD65 (GAD2) (NM_001134366) Human Over-expression Lysate
E45H02068-2 20 µg

GAD65 (GAD2) (NM_001134366) Human Over-expression Lysate

Sign In for Pricing
View Details
ALDH1A2 (NM_170697) Human Tagged Lenti ORF Clone
RC216668L1 10 µg

ALDH1A2 (NM_170697) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
MMP7 Antibody
orb675693-01 50 µg

MMP7 Antibody

Sign In for Pricing
View Details
MMP7 Antibody
orb675693-02 100 µg

MMP7 Antibody

Sign In for Pricing
View Details
COX5A (NM_004255) Human Untagged Clone
SC117461 10 µg

COX5A (NM_004255) Human Untagged Clone

Sign In for Pricing
View Details
LOC728957 (h) : 293T Lysate
sc-112122 100 µg - 200 µL

LOC728957 (h) : 293T Lysate

Sign In for Pricing
View Details