Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant human Lymphotactin protein

Product Specifications

CAS Number

9000-83-3

Gene Name

X-C motif chemokine ligand 1

Gene Aliases

ATAC; c motif chemokine 1; chemokine (C motif) ligand 1; cytokine SCM-1; LPTN; LTN; lymphotactin; lymphotaxin; SCM1; SCM-1; SCM-1a; SCM1A; SCM-1-alpha; SCYC1; single cysteine motif 1a; small inducible cytokine subfamily C, member 1 (lymphotactin) ; small-inducible cytokine C1; XC chemokine ligand 1.

Gene ID

6375

Reactivity

Homo sapiens|Human

Target

Chemotactic activity for lymphocytes but not for monocytes or neutrophils. In thymus, mediates medullary accumulation of thymic dendritic cells and contributes to regulatoy T cell development, playing a role in self-tolerance establishment.

Type

Protein

Source

E.coli

Sequence

VGSEVSDKRTCVSLTTQRLPVSRIKTYTITEGSLRAVIFITKRGLKVCADPQATWVRDVVRSMDRKSNTRNNMIQTKPTGTQQSTNTAVTLTG

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

14.3 kDa

Protein Length

Recombinant

NCBI Gene Symbol

XCL1

Protein Name

Lymphotactin

Gene Name URL

XCL1

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SLC20A1 Human shRNA Lentiviral Particle (Locus ID 6574)
TL309382V 500 µL Each

SLC20A1 Human shRNA Lentiviral Particle (Locus ID 6574)

Sign In for Pricing
View Details
Bismuth (III) Iodide (Bismuth Triiodide)
025225 25 g

Bismuth (III) Iodide (Bismuth Triiodide)

Sign In for Pricing
View Details
16-α Hydroxyestrogen 1 (16-α OHE-1) Rabbit ELISA Kit
B0205 96 Tests

16-α Hydroxyestrogen 1 (16-α OHE-1) Rabbit ELISA Kit

Sign In for Pricing
View Details
CCDC99 Protein Vector (Human) (pPB-C-His)
PV008121 500 ng

CCDC99 Protein Vector (Human) (pPB-C-His)

Sign In for Pricing
View Details
INPP4B Rabbit Polyclonal Antibody (FITC)
orb188670 100 µL

INPP4B Rabbit Polyclonal Antibody (FITC)

Sign In for Pricing
View Details
TRAK1 Mouse Monoclonal Antibody
orb2957492-01 50 µg

TRAK1 Mouse Monoclonal Antibody

Sign In for Pricing
View Details