Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CCN2 Recombinant Protein (Human)

Product Specifications

CAS Number

9000-83-3

Gene Name

Cellular communication network factor 2

Gene Aliases

CCN family member 2; connective tissue growth factor; CTGF; HCS24; hypertrophic chondrocyte-specific protein 24; IBP-8; IGF-binding protein 8; IGFBP8; IGFBP-8; insulin-like growth factor-binding protein 8; NOV2.

Gene ID

1490

Reactivity

Homo sapiens|Human

Target

Major connective tissue mitoattractant secreted by vascular endothelial cells. Promotes proliferation and differentiation of chondrocytes. Mediates heparin- and divalent cation-dependent cell adhesion in many cell types including fibroblasts, myofibroblasts, endothelial and epithelial cells. Enhances fibroblast growth factor-induced DNA synthesis.

Type

Protein

Source

E.coli

Sequence

GKKCIRTPKISKPIKFELSGCTSMKTYRAKFCGVCTDGRCCTPHRTTTLPVEFKCPDGEVMKKNMMFIKTCACHYNCPGDNDIFESLYYRKMYGDMA

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

15.1 kDa

Protein Length

Recombinant

NCBI Gene Symbol

CCN2

Protein Name

Connective tissue growth factor

Gene Name URL

CCN2

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GPR172B Antibody
G723-01 50 μL

GPR172B Antibody

Sign In for Pricing
View Details
GPR172B Antibody
G723-02 100 µL

GPR172B Antibody

Sign In for Pricing
View Details
Olr434 Lentiviral Vector (Rat) (UbC) (pLenti-GIII-UbC)
LV627911 1.0 µg DNA

Olr434 Lentiviral Vector (Rat) (UbC) (pLenti-GIII-UbC)

Sign In for Pricing
View Details
Mouse Smarca1 Pre-designed siRNA Set B
SI113379B 1 Each

Mouse Smarca1 Pre-designed siRNA Set B

Sign In for Pricing
View Details
Rabbit Polyclonal Claudin 10 Antibody
NBP2-92587-0.02mL 0.02 mL

Rabbit Polyclonal Claudin 10 Antibody

Sign In for Pricing
View Details
Vps20-associated 1 homolog (S. cerevisiae)
339591 100 µL

Vps20-associated 1 homolog (S. cerevisiae)

Sign In for Pricing
View Details