Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CXCL12 Recombinant Protein (Mouse)

Product Specifications

CAS Number

9000-83-3

Gene Name

Chemokine (C-X-C motif) ligand 12

Gene Aliases

12-O-tetradecanoylphorbol 13-acetate repressed protein 1; C-X-C motif chemokine 12; PB; Pbsf; PBSF/SD; Pre-B cell growth-stimulating factor; pre-B-cell growth-stimulating factor; Scyb1; Scyb12; Sdf; SDF-; Sdf1; stromal cell-derived factor 1; thymic lymphoma cell-stimulating factor; TLS; Tlsf; TP; Tpar1.

Gene ID

20315

Reactivity

Mouse|Mus musculus

Target

Chemoattractant active on T-lymphocytes and monocytes but not neutrophils. Activates the C-X-C chemokine receptor CXCR4 to induce a rapid and transient rise in the level of intracellular calcium ions and chemotaxis. Also binds to atypical chemokine receptor ACKR3, which activates the beta-arrestin pathway and acts as a scavenger receptor for SDF-1. Binds to the allosteric site (site 2) of integrins and activates integrins ITGAV:ITGB3, ITGA4:ITGB1 and ITGA5:ITGB1 in a CXCR4-independent manner (By similarity) . Acts as a positive regulator of monocyte migration and a negative regulator of monocyte adhesion via the LYN kinase. Stimulates migration of monocytes and T-lymphocytes through its receptors, CXCR4 and ACKR3, and decreases monocyte adherence to surfaces coated with ICAM-1, a ligand for beta-2 integrins. SDF1A/CXCR4 signaling axis inhibits beta-2 integrin LFA-1 mediated adhesion of monocytes to ICAM-1 through LYN kinase. Plays a protective role after myocardial infarction. Induces down-regulation and internalization of ACKR3 expressed in various cells (By similarity) . Has several critical functions during embryonic development; required for B-cell lymphopoiesis, myelopoiesis in bone marrow and heart ventricular septum formation. Stimulates the proliferation of bone marrow-derived B-cell progenitors in the presence of IL7 as well as growth of stromal cell-dependent pre-B-cells (PubMed:8134392) .

Type

Protein

Source

E.coli

Sequence

KPVSLSYRCPCRFFESHIARANVKHLKILNTPNCALQIVARLKNNNRQVCIDPKLKWIQEYLEKALNK

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

12 kDa

Protein Length

Recombinant

NCBI Gene Symbol

Cxcl12

Protein Name

Stromal cell-derived factor 1

Gene Name URL

Cxcl12

More Discoveries

Explore Other Products

Browse additional items from our catalog

5-[3-(4-Nitrosopiperazin-1-yl)propyl]-5H-dibenzo[b,f]azepine
TRC-N732040-100MG 100 mg

5-[3-(4-Nitrosopiperazin-1-yl)propyl]-5H-dibenzo[b,f]azepine

Sign In for Pricing
View Details
Anti-ANXA1 Antibody (Biotin)
STJ500091 100 µg

Anti-ANXA1 Antibody (Biotin)

Sign In for Pricing
View Details
rHSA Pichia
pro-2149 10mg

rHSA Pichia

Sign In for Pricing
View Details
ARID5A Human Over-expression Lysate
orb1355654 100 µg

ARID5A Human Over-expression Lysate

Sign In for Pricing
View Details
Rat IL-4 ELISA Kit
GWB-ZZD045 1x 96 Well Plate

Rat IL-4 ELISA Kit

Sign In for Pricing
View Details
FUS Antibody, FITC conjugated
A39188-50UG 50 µg

FUS Antibody, FITC conjugated

Sign In for Pricing
View Details