What is the catalog number for CXCL10 Recombinant Protein (Mouse)?

The catalog number for CXCL10 Recombinant Protein (Mouse) is OPCA00810-1MG.

What sizes are available for CXCL10 Recombinant Protein (Mouse)?

CXCL10 Recombinant Protein (Mouse) is available in the following size(s): 1 mg.

Is CXCL10 Recombinant Protein (Mouse) in stock?

CXCL10 Recombinant Protein (Mouse) is currently made to order / not held in immediate stock. Contact us for lead time.

CXCL10 Recombinant Protein (Mouse)

Product Specifications

CAS Number

9000-83-3

Gene Name

Chemokine (C-X-C motif) ligand 10

Gene Aliases

10 kDa interferon gamma-induced protein; C7; CRG-; CRG-2; C-X-C motif chemokine 10; gamma-IP10; gIP-; gIP-10; Ifi; Ifi10; IN; INP10; interferon activated gene 10; interferon-gamma induced protein CRG-2; IP; IP-; IP10; IP-10; mob-; mob-1; Scyb1; Scyb10; small inducible cytokine B subfamily (Cys-X-Cys), member 10; small-inducible cytokine B10.

Gene ID

15945

Reactivity

Mouse|Mus musculus

Target

In addition to its role as a proinflammatory cytokine, may participate in T-cell effector function and perhaps T-cell development.

Type

Protein

Source

E.coli

Sequence

IPLARTVRCNCIHIDDGPVRMRAIGKLEIIPASLSCPRVEIIATMKKNDEQRCLNPESKTIKNLMKAFSQKRSKRAP

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.