Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Growth-regulated alpha protein

Product Specifications

CAS Number

9000-83-3

Gene Name

Chemokine (C-X-C motif) ligand 1

Gene Aliases

Alpha-chemokine; C-X-C motif chemokine 1; F; Fsp; Gr; gro; Gro1; GRO1 oncogene; growth-regulated alpha protein; KC; KC/GR) -alpha; KC/GRO-alpha; Mg; Mgsa; N5; N51; platelet-derived growth factor-inducible protein KC; Scyb; Scyb1; secretory protein N51.

Gene ID

14825

Reactivity

Mouse|Mus musculus

Target

Has chemotactic activity for neutrophils. Contributes to neutrophil activation during inflammation (By similarity) . Hematoregulatory chemokine, which, in vitro, suppresses hematopoietic progenitor cell proliferation. KC (5-72) shows a highly enhanced hematopoietic activity.

Type

Protein

Source

E.coli

Sequence

NELRCQCLQTMAGIHLKNIQSLKVLPSGPHCTQTEVIATLKNGREACLDPEAPLVQKIVQKMLKGVPK

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

11.5 kDa

Protein Length

Recombinant

NCBI Gene Symbol

Cxcl1

Protein Name

Growth-regulated alpha protein

Gene Name URL

Cxcl1

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rap1GAP shRNA Plasmid (m)
sc-155959-SH 20 µg

Rap1GAP shRNA Plasmid (m)

Sign In for Pricing
View Details
Cytokeratin 10 (LH2), CF640R conjugate, 0.1mg/mL
BNC400674-500 1x 500 µL

Cytokeratin 10 (LH2), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Commd8 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 2)
K6174407 1.0 µg DNA

Commd8 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 2)

Sign In for Pricing
View Details
Anti-Human Azu1
IT-010-004M1-01 0.1 mg

Anti-Human Azu1

Sign In for Pricing
View Details
Anti-Human Azu1
IT-010-004M1-02 0.5 mg

Anti-Human Azu1

Sign In for Pricing
View Details
Anti-Phospho-STAT3 (Tyr705) Antibody [SZ43-01]
ET1603-40TR 20 µL

Anti-Phospho-STAT3 (Tyr705) Antibody [SZ43-01]

Sign In for Pricing
View Details