Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CCL25 Recombinant Protein (Mouse)

Product Specifications

CAS Number

9000-83-3

Gene Name

Chemokine (C-C motif) ligand 25

Gene Aliases

A130072A22Rik; AI852536; C-C motif chemokine 25; Chemokine TECK; CKb15; Scya; Scya25; small inducible chemokine 25; small inducible cytokine A25; Small-inducible cytokine A25; TECK; thymus-expressed chemokine.

Gene ID

20300

Reactivity

Mouse|Mus musculus

Target

Potentially involved in T-cell development. Recombinant protein shows chemotactic activity on thymocytes, macrophages, THP-1 cells, and dendritics cells but is inactive on peripheral blood lymphocytes and neutrophils. Binds to CCR9. Binds to atypical chemokine receptor ACKR4 and mediates the recruitment of beta-arrestin (ARRB1/2) to ACKR4.

Type

Protein

Source

E.coli

Sequence

GAFEDCCLGYQHRIKWNVLRHARNYHQQEVSGSCNLRAVRFYFRQKVVCGNPEDMNVKRAMRILTARKRLVHWKSASDSQTERKKSNHMKSKVENPNSTSVRSATLGHPRMVMMPRKTNN

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

18 kDa

Protein Length

Recombinant

NCBI Gene Symbol

Ccl25

Protein Name

C-C motif chemokine 25

Gene Name URL

Ccl25

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit anti-Arabidopsis thaliana (Mouse-ear cress) PUB46 Polyclonal Antibody
MBS7193880 Inquire

Rabbit anti-Arabidopsis thaliana (Mouse-ear cress) PUB46 Polyclonal Antibody

Sign In for Pricing
View Details
Duck Hemoglobin Subunit Alpha (HBA) ELISA Kit
MBS9396121 Inquire

Duck Hemoglobin Subunit Alpha (HBA) ELISA Kit

Sign In for Pricing
View Details
ELK2BP Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a)
LV724126 1.0 µg DNA

ELK2BP Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a)

Sign In for Pricing
View Details
Phospho-GLUT1 (Ser490) Antibody
MBS9612799-01 0.1 mL

Phospho-GLUT1 (Ser490) Antibody

Sign In for Pricing
View Details
Phospho-GLUT1 (Ser490) Antibody
MBS9612799-02 0.2 mL

Phospho-GLUT1 (Ser490) Antibody

Sign In for Pricing
View Details
Phospho-GLUT1 (Ser490) Antibody
MBS9612799-03 5x 0.2 mL

Phospho-GLUT1 (Ser490) Antibody

Sign In for Pricing
View Details