Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse C-C motif chemokine 7

Product Specifications

CAS Number

9000-83-3

Gene Name

Chemokine (C-C motif) ligand 7

Gene Aliases

C-C motif chemokine 7; fi; fic; intercrine/chemokine MARC; ma; marc; mcp; MCP-; mcp3; MCP-3; monocyte chemoattractant protein 3; monocyte chemotactic protein 3; Protein FIC; RANTES/sis homolog; Scy; Scya7; small-inducible cytokine A7.

Gene ID

20306

Reactivity

Mouse|Mus musculus

Target

Chemotactic factor that attracts monocytes and eosinophils, but not neutrophils. Augments monocyte anti-tumor activity (By similarity) .

Type

Protein

Source

E.coli

Sequence

PNASTCCYVKKQKIPKRNLKSYRRITSSRCPWEAVIFKTKKGMEVCAEAHQKWVEEAIAYLDMKTPTPKP

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

12.1 kDa

Protein Length

Recombinant

NCBI Gene Symbol

Ccl7

Protein Name

C-C motif chemokine 7

Gene Name URL

Ccl7

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Sesn3 (NM_030261) AAV Particle
MR220914A1V 250 µL

Mouse Sesn3 (NM_030261) AAV Particle

Sign In for Pricing
View Details
Human Eotaxin-3 Antibody
32586-05111 150 µg

Human Eotaxin-3 Antibody

Sign In for Pricing
View Details
Hbb-b2 ORF Vector (Mouse) (pORF)
ORF047002 1.0 µg DNA

Hbb-b2 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
RILPL1 3'UTR Luciferase Stable Cell Line
TU019914 1.0 mL

RILPL1 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Smyd5 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)
K4944308 1.0 µg DNA

Smyd5 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details
Lentiviral mouse Rhcg shRNA (UAS) - Lentiviral mouse Rhcg shRNA (UAS, GFP) plasmid
GTR15222382 1 Vial

Lentiviral mouse Rhcg shRNA (UAS) - Lentiviral mouse Rhcg shRNA (UAS, GFP) plasmid

Sign In for Pricing
View Details