What is the catalog number for CCL2 Recombinant Protein (Mouse)?

The catalog number for CCL2 Recombinant Protein (Mouse) is OPCA00794-1MG.

What sizes are available for CCL2 Recombinant Protein (Mouse)?

CCL2 Recombinant Protein (Mouse) is available in the following size(s): 1 mg.

Is CCL2 Recombinant Protein (Mouse) in stock?

CCL2 Recombinant Protein (Mouse) is currently made to order / not held in immediate stock. Contact us for lead time.

CCL2 Recombinant Protein (Mouse)

Product Specifications

CAS Number

9000-83-3

Gene Name

Chemokine (C-C motif) ligand 2

Gene Aliases

AI323594; C-C motif chemokine 2; HC11; JE; MCA; MCAF; MCP; MCP-; MCP1; MCP-1; monocyte chemoattractant protein 1; monocyte chemotactic protein 1; platelet-derived growth factor-inducible protein JE; Scy; Scya2; Sig; Sigje; small-inducible cytokine A2; SMC-C; SMC-CF.

Gene ID

20296

Reactivity

Mouse|Mus musculus

Target

Chemotactic factor that attracts monocytes, but not neutrophils.

Type

Protein

Source

E.coli

Sequence

QPDAVNAPLTCCYSFTSKMIPMSRLESYKRITSSRCPKEAVVFVTKLKREVCADPKKEWVQTYIKNLDRNQMR

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.