Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CXCL3 Recombinant Protein (Human)

Product Specifications

CAS Number

9000-83-3

Gene Name

C-X-C motif chemokine ligand 3

Gene Aliases

Chemokine (C-X-C motif) ligand 3; CINC-2b; C-X-C motif chemokine 3; GRO3; GRO3 oncogene; GROg; GRO-gamma; GRO-gamma (1-73) ; growth-regulated protein gamma; macrophage inflammatory protein 2-beta; melanoma growth stimulatory activity gamma; MGSA gamma; MIP-2b; MIP2B; MIP2-beta; SCYB3.

Gene ID

2921

Reactivity

Homo sapiens|Human

Target

Ligand for CXCR2 (By similarity) . Has chemotactic activity for neutrophils. May play a role in inflammation and exert its effects on endothelial cells in an autocrine fashion. In vitro, the processed form GRO-gamma (5-73) shows a fivefold higher chemotactic activity for neutrophilic granulocytes.

Type

Protein

Source

E.coli

Sequence

ASVVTELRCQCLQTLQGIHLKNIQSVNVRSPGPHCAQTEVIATLKNGKKACLNPASPMVQKIIEKILNKGSTN

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

11.9 kDa

Protein Length

Recombinant

NCBI Gene Symbol

CXCL3

Protein Name

C-X-C motif chemokine 3

Gene Name URL

CXCL3

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Acetyl tetrapeptide-3 Acetate
TP2364L-01 2 mg

Acetyl tetrapeptide-3 Acetate

Sign In for Pricing
View Details
Acetyl tetrapeptide-3 Acetate
TP2364L-02 5 mg

Acetyl tetrapeptide-3 Acetate

Sign In for Pricing
View Details
Acetyl tetrapeptide-3 Acetate
TP2364L-03 10 mg

Acetyl tetrapeptide-3 Acetate

Sign In for Pricing
View Details
Acetyl tetrapeptide-3 Acetate
TP2364L-04 25 mg

Acetyl tetrapeptide-3 Acetate

Sign In for Pricing
View Details
Acetyl tetrapeptide-3 Acetate
TP2364L-05 50 mg

Acetyl tetrapeptide-3 Acetate

Sign In for Pricing
View Details
Acetyl tetrapeptide-3 Acetate
TP2364L-06 100 mg

Acetyl tetrapeptide-3 Acetate

Sign In for Pricing
View Details