Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant human Myelin P2 protein

Product Specifications

CAS Number

9000-83-3

Gene Name

Peripheral myelin protein 2

Gene Aliases

CMT1G; FABP8; M-FABP; MP2; myelin P2 protein; P2; Peripheral myelin protein 2.

Gene ID

5375

Reactivity

Homo sapiens|Human

Target

May play a role in lipid transport protein in Schwann cells. May bind cholesterol.

Type

Protein

Source

E.coli

Sequence

MSNKFLGTWKLVSSENFDDYMKALGVGLATRKLGNLAKPTVIISKKGDIITIRTESTFKNTEISFKLGQEFEETTADNRKTKSIVTLQRGSLNQVQRWDGKETTIKRKLVNGKMVAECKMKGVVCTRIYEKV

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

41.9 kDa

Protein Length

Recombinant

NCBI Gene Symbol

PMP2

Protein Name

Myelin P2 protein

Gene Name URL

PMP2

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD19 Recombinant Rabbit mAb,PBS Only (SDT-164-41)
S0B2213P 100 μg

CD19 Recombinant Rabbit mAb,PBS Only (SDT-164-41)

Sign In for Pricing
View Details
Anti-H5N1(A/Hong Kong/483/97)
VACY-0922-CY79 Each

Anti-H5N1(A/Hong Kong/483/97)

Sign In for Pricing
View Details
CACNB1 Rabbit Polyclonal Antibody (Cy5.5)
orb1080796 100 µL

CACNB1 Rabbit Polyclonal Antibody (Cy5.5)

Sign In for Pricing
View Details
Human Colletin-10 (Colletin-10) ELISA Kit
YP-W13693-01 48 Tests

Human Colletin-10 (Colletin-10) ELISA Kit

Sign In for Pricing
View Details
Human Colletin-10 (Colletin-10) ELISA Kit
YP-W13693-02 96 Tests

Human Colletin-10 (Colletin-10) ELISA Kit

Sign In for Pricing
View Details
Mouse Tetratricopeptide repeat protein 28 (TTC28) ELISA Kit
abx551717 96 Tests

Mouse Tetratricopeptide repeat protein 28 (TTC28) ELISA Kit

Sign In for Pricing
View Details