Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant human Myelin P2 protein

Product Specifications

CAS Number

9000-83-3

Gene Name

Peripheral myelin protein 2

Gene Aliases

CMT1G; FABP8; M-FABP; MP2; myelin P2 protein; P2; Peripheral myelin protein 2.

Gene ID

5375

Reactivity

Homo sapiens|Human

Target

May play a role in lipid transport protein in Schwann cells. May bind cholesterol.

Type

Protein

Source

E.coli

Sequence

MSNKFLGTWKLVSSENFDDYMKALGVGLATRKLGNLAKPTVIISKKGDIITIRTESTFKNTEISFKLGQEFEETTADNRKTKSIVTLQRGSLNQVQRWDGKETTIKRKLVNGKMVAECKMKGVVCTRIYEKV

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

41.9 kDa

Protein Length

Recombinant

NCBI Gene Symbol

PMP2

Protein Name

Myelin P2 protein

Gene Name URL

PMP2

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rpl18 (NM_009077) Mouse Tagged ORF Clone
MR215733 10 µg

Rpl18 (NM_009077) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Human Calu (Calumenin) ELISA Kit
FY-EH1988 96 Well

Human Calu (Calumenin) ELISA Kit

Sign In for Pricing
View Details
Human Thimet oligopeptidase (THOP1) ELISA Kit
AE17350HU-01 48 Tests

Human Thimet oligopeptidase (THOP1) ELISA Kit

Sign In for Pricing
View Details
Human Thimet oligopeptidase (THOP1) ELISA Kit
AE17350HU-02 96 Tests

Human Thimet oligopeptidase (THOP1) ELISA Kit

Sign In for Pricing
View Details
2-Amino-4- (thiophen-2-yl) thiophene-3-carboxamide
DPA77294-01 0.5 g

2-Amino-4- (thiophen-2-yl) thiophene-3-carboxamide

Sign In for Pricing
View Details
2-Amino-4- (thiophen-2-yl) thiophene-3-carboxamide
DPA77294-02 5 g

2-Amino-4- (thiophen-2-yl) thiophene-3-carboxamide

Sign In for Pricing
View Details