Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant rat Thrombopoietin

Product Specifications

CAS Number

9000-83-3

Gene Name

Thrombopoietin|thrombopoietin like 1

Gene Aliases

Thpo; thrombopoietin.

Gene ID

108348162|81811

Reactivity

Rat|Rattus norvegicus

Target

Lineage-specific cytokine affecting the proliferation and maturation of megakaryocytes from their committed progenitor cells. It acts at a late stage of megakaryocyte development. It may be the major physiological regulator of circulating platelets.

Type

Protein

Source

E.coli

Sequence

SPVPPACDPRLLNKLLRDSYLLHSRLSQCPDVNPLSIPVLLPAVDFSLGEWKTQTEQSKAQDILGAVSLLLEGVMAARGQLEPSCLSSLLGQLSGQVRLLLGALQGLLGTQLPPQGRTTAHKDPSALFLSLQQLLRGKVRFLLLVEGPALCVRRTLPTTAVPSRTSQLLTLNK

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

45.6 kDa

Protein Length

Recombinant

NCBI Gene Symbol

LOC108348162|Thpol1

Protein Name

Thrombopoietin

Gene Name URL

LOC108348162|Thpol1

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Achaete scute homolog 3 (ASCL3) Rabbit Polyclonal Antibody
TA342342 100 µL

Achaete scute homolog 3 (ASCL3) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
STX19 (NM_001001850) Human Tagged ORF Clone Lentiviral Particle
RC204505L3V 200 µL

STX19 (NM_001001850) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
CXCL13 sgRNA CRISPR Lentivector (Human) (Target 1)
K0535802 1.0 µg DNA

CXCL13 sgRNA CRISPR Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
Sheep alkaline phosphatase (ALP) ELISA Kit
YP-W72930-01 48 Tests

Sheep alkaline phosphatase (ALP) ELISA Kit

Sign In for Pricing
View Details
Sheep alkaline phosphatase (ALP) ELISA Kit
YP-W72930-02 96 Tests

Sheep alkaline phosphatase (ALP) ELISA Kit

Sign In for Pricing
View Details
Recombinant Haemophilus parasuis serovar 5 UPF0319 protein HAPS_0727 (HAPS_0727)
MBS1013026-01 0.02 mg (E-Coli)

Recombinant Haemophilus parasuis serovar 5 UPF0319 protein HAPS_0727 (HAPS_0727)

Sign In for Pricing
View Details