What sizes are available for Recombinant human Vascular endothelial growth factor D?

Recombinant human Vascular endothelial growth factor D is available in the following size(s): 20 µg.

Recombinant human Vascular endothelial growth factor D

Q: What is the catalog number for Recombinant human Vascular endothelial growth factor D?

The catalog number for Recombinant human Vascular endothelial growth factor D is OPCA00707-20UG.

Q: Is Recombinant human Vascular endothelial growth factor D in stock?

Recombinant human Vascular endothelial growth factor D is currently made to order / not held in immediate stock. Contact us for lead time.

Product Specifications

CAS Number

9000-83-3

Gene Name

Vascular endothelial growth factor D

Gene Aliases

C-fos induced growth factor (vascular endothelial growth factor D) ; c-Fos-induced growth factor; FIGF; vascular endothelial growth factor D; VEGF-D.

Gene ID

2277

Reactivity

Homo sapiens|Human

Target

Growth factor active in angiogenesis, lymphangiogenesis and endothelial cell growth, stimulating their proliferation and migration and also has effects on the permeability of blood vessels. May function in the formation of the venous and lymphatic vascular systems during embryogenesis, and also in the maintenance of differentiated lymphatic endothelium in adults. Binds and activates VEGFR-2 (KDR/FLK1) and VEGFR-3 (FLT4) receptors.

Type

Protein

Source

E.coli

Sequence

FAATFYDIETLKVIDEEWQRTQCSPRETCVEVASELGKSTNTFFKPPCVNVFRCGGCCNEESLICMNTSTSYISKQLFEISVPLTSVPELVPVKVANHTGCKCLPTAPRHPYSIIRR

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.