Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant human Vascular endothelial growth factor D

Product Specifications

CAS Number

9000-83-3

Gene Name

Vascular endothelial growth factor D

Gene Aliases

C-fos induced growth factor (vascular endothelial growth factor D) ; c-Fos-induced growth factor; FIGF; vascular endothelial growth factor D; VEGF-D.

Gene ID

2277

Reactivity

Homo sapiens|Human

Target

Growth factor active in angiogenesis, lymphangiogenesis and endothelial cell growth, stimulating their proliferation and migration and also has effects on the permeability of blood vessels. May function in the formation of the venous and lymphatic vascular systems during embryogenesis, and also in the maintenance of differentiated lymphatic endothelium in adults. Binds and activates VEGFR-2 (KDR/FLK1) and VEGFR-3 (FLT4) receptors.

Type

Protein

Source

E.coli

Sequence

FAATFYDIETLKVIDEEWQRTQCSPRETCVEVASELGKSTNTFFKPPCVNVFRCGGCCNEESLICMNTSTSYISKQLFEISVPLTSVPELVPVKVANHTGCKCLPTAPRHPYSIIRR

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

40.1 kDa

Protein Length

Recombinant

NCBI Gene Symbol

VEGFD

Protein Name

Vascular endothelial growth factor D

Gene Name URL

VEGFD

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Interleukin 31 Receptor A (Interleukin-31 Receptor Subunit alpha, IL-31 Receptor Subunit alpha, IL-31R Subunit alpha, IL-31R-alpha, IL-31RA, IL31RA, Cytokine Receptor-like 3, CRL3, CRL, gp130-Like Monocyte Receptor, Gp130-like Receptor, GLM-R, hGLM-R, GLM
MBS6222774-01 0.1 mL

Interleukin 31 Receptor A (Interleukin-31 Receptor Subunit alpha, IL-31 Receptor Subunit alpha, IL-31R Subunit alpha, IL-31R-alpha, IL-31RA, IL31RA, Cytokine Receptor-like 3, CRL3, CRL, gp130-Like Monocyte Receptor, Gp130-like Receptor, GLM-R, hGLM-R, GLM

Ask
View Details
Interleukin 31 Receptor A (Interleukin-31 Receptor Subunit alpha, IL-31 Receptor Subunit alpha, IL-31R Subunit alpha, IL-31R-alpha, IL-31RA, IL31RA, Cytokine Receptor-like 3, CRL3, CRL, gp130-Like Monocyte Receptor, Gp130-like Receptor, GLM-R, hGLM-R, GLM
MBS6222774-02 5x 0.1 mL

Interleukin 31 Receptor A (Interleukin-31 Receptor Subunit alpha, IL-31 Receptor Subunit alpha, IL-31R Subunit alpha, IL-31R-alpha, IL-31RA, IL31RA, Cytokine Receptor-like 3, CRL3, CRL, gp130-Like Monocyte Receptor, Gp130-like Receptor, GLM-R, hGLM-R, GLM

Ask
View Details
Casearin D
TBZ0141 unit

Casearin D

Ask
View Details
RFP Polyclonal Antibody, AbBy Fluor™ 405 Conjugated
bs-33011R-BF405 100 µL

RFP Polyclonal Antibody, AbBy Fluor™ 405 Conjugated

Ask
View Details
Anti-IKB epsilon/Nfkbie Antibody Picoband®, FITC Conjugate
A07073-1-FITC 100 µg/Vial

Anti-IKB epsilon/Nfkbie Antibody Picoband®, FITC Conjugate

Ask
View Details
Recombinant Human FOLH1/PSMA, N-Strep
MBS1575945-01 0.1 mg

Recombinant Human FOLH1/PSMA, N-Strep

Ask
View Details